KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083306
Entry
103083306         CDS       T03090                                 

Gene name
ATF4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04137  Mitophagy - animal
lve04141  Protein processing in endoplasmic reticulum
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04211  Longevity regulating pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04668  TNF signaling pathway
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04728  Dopaminergic synapse
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04918  Thyroid hormone synthesis
lve04922  Glucagon signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04932  Non-alcoholic fatty liver disease
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05014  Amyotrophic lateral sclerosis
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05034  Alcoholism
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05203  Viral carcinogenesis
lve05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103083306 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083306 (ATF4)
   04668 TNF signaling pathway
    103083306 (ATF4)
   04022 cGMP-PKG signaling pathway
    103083306 (ATF4)
   04151 PI3K-Akt signaling pathway
    103083306 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103083306 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    103083306 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103083306 (ATF4)
   04922 Glucagon signaling pathway
    103083306 (ATF4)
   04912 GnRH signaling pathway
    103083306 (ATF4)
   04915 Estrogen signaling pathway
    103083306 (ATF4)
   04926 Relaxin signaling pathway
    103083306 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    103083306 (ATF4)
   04918 Thyroid hormone synthesis
    103083306 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    103083306 (ATF4)
   04925 Aldosterone synthesis and secretion
    103083306 (ATF4)
   04927 Cortisol synthesis and secretion
    103083306 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103083306 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    103083306 (ATF4)
   04728 Dopaminergic synapse
    103083306 (ATF4)
   04720 Long-term potentiation
    103083306 (ATF4)
   04722 Neurotrophin signaling pathway
    103083306 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    103083306 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103083306 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103083306 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103083306 (ATF4)
   05012 Parkinson disease
    103083306 (ATF4)
   05014 Amyotrophic lateral sclerosis
    103083306 (ATF4)
   05020 Prion disease
    103083306 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    103083306 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    103083306 (ATF4)
   05031 Amphetamine addiction
    103083306 (ATF4)
   05034 Alcoholism
    103083306 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103083306 (ATF4)
   04934 Cushing syndrome
    103083306 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103083306 (ATF4)
   05161 Hepatitis B
    103083306 (ATF4)
   05163 Human cytomegalovirus infection
    103083306 (ATF4)
Transcription factors [BR:lve03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103083306 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB Fez1 DUF3450 DUF4407 bZIP_Maf
Other DBs
NCBI-GeneID: 103083306
NCBI-ProteinID: XP_007454058
UniProt: A0A340WXH5
LinkDB
Position
Un
AA seq 350 aa
MAEKSFLSSEVLVVDFMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSGDKAKAGISE
WLAMDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFNALLGIDDLETMPDELLATLDDTC
DLFDPLLQEATKEPPQIVNPIGHVPESLPTTDQGAPFTFLQPLPLSPGALFSTPDHSFTL
ELCSEVMSEEDRKPDSTAYVMLIPQRVKEEDAPSDNDSGICMSPDSYLGSPQHSPSTSRG
SPNRSLLSPGAPGGSARPKPYDPPGEKMIAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEQKNEALKEKAASLAKEIQYLKDLIEEVRKARGKRRI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggccgagaagagcttcctgagcagcgaggtgttggtggtggacttcatgtcccccttc
gaccagtcgggtttgggggctgaagagagcctgggtctcctagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctctggcgacaaggctaaggcgggcatctccgaa
tggctggctatggatgggttggtcagtgcctcagataacggcaaggaggatgctttctct
gggacagattggatggtggagaaaatggatctgaaggagtttgattttaatgctctgttg
ggtatagatgatctggaaaccatgccagatgagcttttggccacgttggatgacacgtgt
gatctctttgaccccctactccaggaggctactaaggagcccccccagatcgtgaaccca
ataggccatgttccagaaagtttgccaacaactgaccagggtgcccctttcactttcttg
cagcctctccccctctccccaggggccctgttctccactccagatcattcttttacttta
gagctatgcagtgaagtgatgtctgaagaagataggaagccagactccactgcttacgtt
atgctgatccctcagcgcgtaaaggaagaggatgccccctcagataatgatagtggcatc
tgtatgagccctgactcctatctgggctctccccagcacagcccctctacctccaggggt
tctccaaatagaagcctgctatctccaggtgcccctggtggctctgcccgccccaagccc
tatgaccctcctggagagaagatgatagcagcaaaagtaaagggtgagaaactagataag
aaactgaagaaaatggagcagaacaagacagcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggtgaatgtaaagagctagaacagaagaacgaggctctg
aaagagaaggcagcttccttggccaaggagatccagtatctgaaagatttaatagaagag
gtccgcaaggcaagggggaagaggaggatctag

DBGET integrated database retrieval system