KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083385
Entry
103083385         CDS       T03090                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04120  Ubiquitin mediated proteolysis
lve04530  Tight junction
lve04622  RIG-I-like receptor signaling pathway
lve04722  Neurotrophin signaling pathway
lve04912  GnRH signaling pathway
lve04935  Growth hormone synthesis, secretion and action
lve05161  Hepatitis B
lve05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103083385 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083385 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103083385 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103083385 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083385 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    103083385 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103083385 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103083385 (MAP3K1)
   05161 Hepatitis B
    103083385 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103083385 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lve04121]
    103083385 (MAP3K1)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103083385 (MAP3K1)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE11 family
   103083385 (MAP3K1)
Ubiquitin system [BR:lve04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    103083385 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH Phostensin_N zf-ANAPC11
Other DBs
NCBI-GeneID: 103083385
NCBI-ProteinID: XP_007450819
UniProt: A0A340WUT6
LinkDB
Position
Un
AA seq 1926 aa
MAAAAGNRASSSGFPGAGAANPEAGGGGGALKASSTPTAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEPPLFLTASPPSSSTSPSPEPADAAAGGSGFQPVAVPPPHGPGEQG
GRGRGGDLGGGRARSMNEPRAPRRASRGSAQRGCTPLAGSPRAPPLTLPASGGAPDLAWG
TGRDGGPGRGLAGEFVIVCRHVTGVRAALRVPVEIRYRGPGWDEGCAPGGGAGARRRKRW
GPRGCDSQSLSAGTGGRAGTKAARPERGRRGLRVDGSVTSVKEVWADRLQMLGGLRSFRT
WGLLLAEWCKSQDRMCQPFSFKAVVTAPRSLSGVVGDRGAGAVLPAPCSCAGRRRLPASR
GRSAVAPAPLEPYCLCATVCVRGTVSGKYFGAKQCTVSPPYLRLQNSQGQHRVVMRMLDP
RSQILLGTYCRWTPKKSLNFSEPHISHLENGNDMNTKVTFLHQMFRGLLSVQAFRVALAF
FDPLPNCLFIECPLCARERAELLFSFGSSGLQGRDMLGFISVQNKGPVKFLHIHVASGEH
GDSPPGEGAFCGLSRTFGTDDRRMSKMWQPVPEELPVCREMENKETLKGLHKMDDRPEER
MIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEINTLAAESQGEGQASAASS
APKGRRSPSPGSSPSGRTVKSESPGVRRKKVSPVPFQSGRITPPRRAPSPDGFSPYSPEE
TNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLFVML
RVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSS
SSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNR
EPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTTQQHPLAGSQRRSQESNFNLT
HYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGES
TGNSGSNGGSSPSAGAASGSSQTSVSGDVVEACCNVLSMVCADPVYKVYVAALKTLRAML
VYTPCHSLAERIKLQRLLRPVVDTILVKCADVNSRTSQLSISTLLELCKGQAGELAVGRE
ILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAGFYPHTVSTDVS
QIECVFSFRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTAVPHVFSKLLEML
NVSSSTYFTRMRRRLMAIADEVEIAEAIQLGIEDTLNGRHDSFLKASVPNSCPEATENSY
FERTDHLEKTGKGLCATKLSASSEDISDRLASISVGLPSSTTMEQPKPMVQTKGRPHSQC
LNSSPLSHHSQLMFPALSSPSSSAPSVPPGTVTDVSKHRPQGFVPCKIPSASPQTQRKFS
LQFQRNCSENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPSNTSKQGDASKNSMTLDLN
TSSKCDDGFGSSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTT
VTFKSEVAVLSPEKDENDDTYKDDMNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVP
QLQVENGEDIIIIQKDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTG
TLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWM
AGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRI
ADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAK
PPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHP
VFRTTW
NT seq 5781 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcctcgggattcccgggcgccggggcggcg
aacccagaagcgggcggcggcggaggggccctcaaggcgagcagcacacccacggcagcc
gcggggctgctgcgggaggcgggcagtgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcccgagccgccgcttttcctc
accgcctcgccgccgtcctcctccacttccccgtcgccggagcccgcggacgcggccgct
ggcgggagcggtttccagcctgtggcggtgccgccgccccacggaccgggtgagcagggc
ggccgggggcgcggtggggacttggggggcgggcgggcgaggtcaatgaatgaaccccgg
gcaccgcgcagagcgtcccggggctccgcgcagcgaggctgcacgccgctcgccgggagc
cctagggcaccccctttgacccttccggcgtcgggcggcgccccggacctggcctggggt
actggacgggatgggggcccggggcggggacttgcgggagagtttgttattgtttgcaga
catgtgacaggcgtgcgagccgcgctgcgagtaccggttgagataaggtaccgggggccg
ggctgggacgaaggctgcgcgcccggtgggggggccggagcgcggcggagaaagcggtgg
ggtccccgcggctgtgacagtcagagtctctcggcaggtaccgggggccgggctgggacg
aaggctgcgcgcccggagcgcggccgcagggggctccgggtggacggctccgtaacgtct
gtcaaagaggtgtgggctgaccggctgcaaatgctcgggggcttgcgatcttttaggacg
tggggtttgcttttggcggagtggtgtaagagccaggaccggatgtgtcagccattcagt
ttcaaagcggtggtgactgctccccgcagcctctccggcgtggttggggaccgcggcgcg
ggtgcggtacttcctgctccgtgcagctgcgcgggccgccgccgactgccggcttccagg
ggacgcagtgctgtggctccggctccgttagagccgtactgcctgtgcgctacggtgtgt
gtaagaggtacagtctcaggaaaatattttggtgccaagcagtgtacagtcagccctcca
tatctgaggttgcagaactcgcaggggcagcacagggtagtgatgaggatgctggacccg
aggagtcagatccttttaggcacttactgtcgctggactccaaagaagtcacttaacttc
tctgaacctcacatttctcatcttgaaaatgggaatgacatgaacactaaagtgaccttc
ctgcaccagatgttcagaggattgctttctgtccaagccttccgggtggctcttgcattt
ttcgaccctcttcctaattgcttgtttatcgaatgtcctctgtgtgccagggaacgtgct
gagttactgttttcattcggctcttcggggttgcagggaagagacatgttagggtttatt
tcagtgcaaaataaaggacccgtgaagtttctgcacatacatgtggcctctggagaacat
ggtgattcaccacctggggagggtgccttttgtggcctgtccaggacatttggcactgat
gatagaagaatgagtaagatgtggcagcctgtcccagaagagctcccagtgtgtcgtgag
atggagaataaagaaactctcaaggggttgcacaagatggacgatcgcccagaagaacga
atgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaatggctggaa
aggagaaacaggagaggccctgtggtggtaaaaccaatccctattaaaggagatggatct
gaaattaataccttggcagctgagtctcaaggagagggccaggcaagcgctgcttcctca
gctcccaaaggccgacgcagtccttcccctggcagctccccatcaggccgcacagtgaaa
tctgaatctccaggagtaaggagaaaaaaagtttccccggtgccttttcagagcgggaga
atcacaccacctcgaagagccccttcaccagatggcttctcaccatacagccctgaggaa
acaaaccgccgtgtaaacaaagtgatgcgggcgaggctgtacttactgcagcaaataggg
cccaactccttcctgattggaggagacagcccagacaataaataccgggtgtttattggg
cctcagaactgcagctgtgggcgtggaacattctgtattcatctgctatttgttatgctc
cgagtgtttcagctagaaccttcagacccaatgttatggaggaaaactttaaagaatttt
gaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatcaaagctcca
tctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcatacattgtcatca
tctagcacttctacatctagttcagaaaacagtataaaagatgaagaggaacagatgtgt
cctatttgcttgttgggcatgcttgatgaagaaagtcttacagtgtgtgaagatggctgc
aggaacaagctgcaccaccactgcatgtcaatttgggcagaagaatgtagaagaaacaga
gaacctttaatatgtcccctttgtaggtctaagtggagatcccatgatttctacagccac
gagttgtcaagccctgtggattccccttcttccctgcgagctgcacagcagcaaaccaca
cagcagcatcccttggctggatcacaacgaaggagtcaagagagcaattttaatcttact
cattatggaactcagcagatccctcctgcttataaagatttagctgagccatggattcag
gtatttggaatggaactcgttggctgcttattttctagaaactggaatgtaagagagatg
gctctcagacgtctttcccatgatgttagcggggctctgctgttggcaaatggggagagc
actggaaattccgggagcaacggcgggagcagcccaagtgctggagctgccagtgggtct
tcccagaccagtgtctcaggagatgtggtggaggcatgctgcaacgttttgtcaatggtc
tgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacgttgagagccatgcta
gtatatactccttgccatagtttggcagaaagaatcaaactgcagagacttctccggcca
gttgtagacaccatcctagtcaagtgtgcagacgtcaatagtcgcacaagtcagctgtct
atatcaacgctattggaattgtgcaaaggccaagcaggagagttggccgttggcagagaa
atacttaaagctggatccattggtattggtggtgttgattatgtcttaaattgtattctt
ggaaaccaaactgaatcaaacaactggcaagaactcctgggccgcctttgtctcatagat
agactgctgttggaatttcctgctggattttaccctcatactgtcagtactgatgtttca
caaattgaatgtgttttttctttcaggtataagaagctgctgtccctcttaacctttgct
ttgcagtccattgataattcccactcaatggttggtaaactctccagaaggatatatttg
agttctgcaagaatggttactgcagtaccccatgtattttcaaaactgttagaaatgctg
aatgtttccagttctacttattttaccaggatgcgtcgtcgtttgatggctattgcagat
gaggtggaaattgctgaggccatccagctgggcatagaagacactttgaatggtcgacat
gacagctttttgaaagcatcagtccctaacagctgtccagaagccacagagaacagttac
tttgagcgcacagaccatttagagaaaactggaaaaggattgtgtgctacaaaattgagt
gccagttcagaggacatttctgaccgactggccagcatttcagtaggacttcctagttca
acaacaatggagcagccaaagccaatggttcaaacaaaaggcagaccccacagtcagtgt
ttgaactcctctcctttatctcaccattcccaactaatgttcccagccttgtcaagccct
tcttcatctgccccatctgtaccacctggcaccgtaacagatgtctctaagcacagacct
caggggtttgttccctgcaaaataccttctgcatctcctcaaacacagcgcaagttttct
ctacagttccagagaaactgttctgaaaacaaagattcagataaactttccccagtcttt
actcagtcaagacccctgccctccagtaatatacacaggccaaagccatctcgacctacc
ccaagtaatacaagtaaacagggagatgcctcaaaaaatagcatgacacttgatttgaac
actagttccaaatgtgatgatggctttggcagcagcagcaatagcagtaatgctgttata
cctagtgacgagacagtgttcaccccagtagaggagaaatgcagattagatgtcaataca
gagctcaactccagtattgaggaccttcttgaagcatctatgccttcaagtgacacaaca
gtaacttttaagtcagaagttgctgtgctgtctcctgaaaaggatgaaaatgatgatacc
tacaaagatgatatgaatcataatcagaagtgcaaagaaaaaatggaagctgaagaagaa
gaagctttagcgattgccatggcaatgtcagcatctcaggatgccctccccatagttcct
caactacaggttgaaaatggagaagacatcatcatcattcaaaaagatacaccagagact
ctaccaggacataccaaagcaaaacaaccttatagagaagacactgaatggctgaaaggt
cagcagataggccttggagcattttcttcttgttatcaggctcaagatgtgggaactgga
actttaatggctgttaaacaggtgacgtatgtcagaaatacatcttctgagcaagaagaa
gtagtagaagcattaagggaggagataagaatgatgagccatctgaaccatccaaacatc
attaggatgttgggagccacatgtgagaagagcaattataatctcttcattgaatggatg
gcagggggatctgtggctcatttgctcagtaaatatggagccttcaaggaatcagtagtt
attaactatactgaacaattacttcgtggcctttcatatctccatgaaaaccagatcatt
cacagagatgtcaaaggtgccaatttgctaattgacagcacaggtcagagactgagaatt
gctgattttggagctgcagccaggttggcatcaaaaggaactggtgcaggagagtttcag
ggacaattattggggacaattgcatttatggcacctgaggtcctaagaggtcagcagtat
ggtaggagctgtgatgtatggagtgttggctgtgctattatagaaatggcttgtgctaaa
ccaccttggaatgcagaaaaacactccaatcatcttgctttgatatttaagattgccagt
gcaactactgctccatcaatcccttcacatttgtctcctggtttacgagatgtggctctt
cgctgtttagaacttcaacctcaggacagacctccatcaagagagctactgaagcatcca
gtcttccgtactacgtggtag

DBGET integrated database retrieval system