KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083510
Entry
103083510         CDS       T03090                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve00590  Arachidonic acid metabolism
lve00591  Linoleic acid metabolism
lve00592  alpha-Linolenic acid metabolism
lve01100  Metabolic pathways
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04072  Phospholipase D signaling pathway
lve04217  Necroptosis
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04611  Platelet activation
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103083510 (PLA2G4D)
   00565 Ether lipid metabolism
    103083510 (PLA2G4D)
   00590 Arachidonic acid metabolism
    103083510 (PLA2G4D)
   00591 Linoleic acid metabolism
    103083510 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    103083510 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083510 (PLA2G4D)
   04014 Ras signaling pathway
    103083510 (PLA2G4D)
   04370 VEGF signaling pathway
    103083510 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    103083510 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103083510 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103083510 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    103083510 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    103083510 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083510 (PLA2G4D)
   04913 Ovarian steroidogenesis
    103083510 (PLA2G4D)
   04921 Oxytocin signaling pathway
    103083510 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103083510 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    103083510 (PLA2G4D)
   04726 Serotonergic synapse
    103083510 (PLA2G4D)
   04730 Long-term depression
    103083510 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103083510 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103083510 (PLA2G4D)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103083510 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 103083510
NCBI-ProteinID: XP_007460259
UniProt: A0A340XLW7
LinkDB
Position
Un
AA seq 818 aa
MERMTPRGPPGHPHQGETSTCWQLTVRVLEARGLGWADLLSKADPYVILQLPTAPGTKFK
TKTVTNSSHPVWNETFTFLIQSQVKNVLELSIYDKDAVKTDDACFKVLCDVSEXLPGRLL
WNTFSLHPQGPEELDVEFLMEKTSGCPENLITSNVLVARELSCLDVHLDSMGSTAEAADQ
DELELELVLKGSYEDTQTSALGTASAFCFHYMAAQEAELSGCLRTSKSNGWNSGNSAGYL
TVPLRSLAIREEVTVDVPATNAPGVKLQLKTESCPKELAVHLGFDLCAEEKAFLSRRKQV
VAKALKQAPQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSHRDLKGPIGHAREHLAKSKLEAFSPERLASYHRELEQRAEQGY
PTTFVDLWGLVLEFALHGQVMDQKLSGQRAALEWGQNPLPLYLSLNVKENNLQTLDFKEW
VEFSPYEVGFLKYGAFIPSELFGSEFFMGRLMRRIPESRICFLEGIWSNIFSLNLLDAWY
DLTSSSDAWKQHIKDKIRNLERNPPPSSGTSSGPEALWLQPGTALAQMLKGFLTSRPLYQ
HSSNFLQGLQLHQDYCAQKDFSTWADRQVDSSAGQLTPQEPQLCLVGAGYFLNTSCPSMF
RPGRRLDLIISXDYSLPSPFEVLQQTELDCRARGLPFPHVEPSLQDRRQPRECHLFSDPT
CPDAPVLLHFPLVNASFRDHSAPGVQRSPAELPAGQVDLTGVNSPYSMFNMTYKEEDFDR
LLQLSDYNVRNSQGTILQALRTSLRHRAPGPRPPEPQA
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggagagaatgacacctaggggaccacctggccatcctcaccagggggagacctctacc
tgctggcagctcaccgtgagggtcctggaggcacggggcctgggctgggctgacctcttg
agcaaggcagacccctatgtgatcctacagctgccaaccgcacctggaacaaagtttaag
acaaaaacagtcaccaactccagtcatcctgtgtggaacgagaccttcactttcctgatc
caaagtcaggtcaagaatgttctggagctgagcatctatgacaaggatgccgtcaagacg
gacgacgcctgcttcaaggttctctgtgatgtctctgaangcctccctggcaggttgctc
tggaacaccttctccctgcatccccagggaccggaggagctggacgtggagttcctgatg
gagaaaacgtcaggctgcccagaaaacctcatcaccagcaacgtgcttgtggcccgagaa
ctgtcttgcctggatgttcatctggacagcatggggagcacagccgaggctgcagatcag
gacgagctggagctggagctggtgctgaagggctcatatgaggacacacagacatctgcc
ctgggaacagcctctgccttctgcttccactacatggcagcccaagaggcagagctgagt
gggtgcctgaggacctctaaaagcaatggctggaactcaggcaactcagctgggtacctc
actgtacccctaaggtccttggccatcagggaggaggtgacagttgacgttcctgctaca
aatgccccaggagtgaagctgcagctcaagactgagagctgcccgaaggagctggctgtg
catctgggcttcgatttgtgtgcggaggagaaagccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccccacagctggacagagacctacaggaagatgaggtc
cccgtcgtgggcatcatggccacaggaggaggtgcccgggccatgacctctctctatggc
cacctgttggccctgcagaagctgggccttctggactgtgtgacctacttcagtggcatc
tcgggctctacatggacaatggcccatctgtatggggaccctgagtggtcgcacagagac
ctgaagggacccattggacacgcccgggagcacctggccaagagcaagctggaggccttc
tctcctgagcgcctggcgagctaccatcgggagctggaacaacgggctgagcagggctac
cccacaacctttgtggacctgtggggtctggtgctggagttcgcgctgcacggacaggtg
atggatcagaagctgtcgggacagagagctgcgctggagtggggccagaaccctctgccc
ctctacctgagcctcaatgtcaaagagaacaatctgcagaccctggacttcaaggagtgg
gtcgagttctccccctacgaggtcgggttcctgaagtacggcgccttcatcccctctgag
ctcttcggctcggagttcttcatggggcggctgatgaggaggatccccgagtcccgaatc
tgcttcctggaaggtatctggagcaacattttctccctgaacttgctggatgcctggtat
gacctcaccagctccagtgacgcctggaagcagcacatcaaggacaagatcaggaacctg
gagaggaatcctcctccctcctcggggacctcctcagggccggaggccttgtggctccag
cctggaacagcgctagcccagatgttgaagggcttcctgacgagcagaccactctaccag
cacagctccaacttcctccagggcctccagctgcaccaggactactgtgcccagaaggac
ttctccacctgggcagaccgccaggtagactcctccgccgggcagctgaccccacaggag
ccccagctctgcttggtgggtgccggctacttcctcaacaccagctgtccctccatgttc
cggccaggccgcaggctggacctcataatctccntcgactactctctaccctcgcccttt
gaggtgctgcagcagacggagctagactgccgggcccgggggctgccgttcccccacgtg
gagcccagccttcaggaccgacgccagccccgggagtgccacctcttctcagaccctacc
tgccctgatgcccctgtcctgcttcacttcccgctggtaaacgcctccttcagggaccac
tcagccccaggtgtccagcgcagccctgcagagctcccagcaggccaggtggatctcaca
ggggtcaactccccctattccatgttcaacatgacctacaaggaggaagattttgaccgc
ctgctgcagctcagtgactacaacgtacggaacagccagggcaccatcctgcaggctttg
aggacctctctgagacacagggccccggggcccaggcctccagagccgcaggcttga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083784
Entry
103083784         CDS       T03090                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve00590  Arachidonic acid metabolism
lve00591  Linoleic acid metabolism
lve00592  alpha-Linolenic acid metabolism
lve01100  Metabolic pathways
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04072  Phospholipase D signaling pathway
lve04217  Necroptosis
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04611  Platelet activation
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103083784 (PLA2G4E)
   00565 Ether lipid metabolism
    103083784 (PLA2G4E)
   00590 Arachidonic acid metabolism
    103083784 (PLA2G4E)
   00591 Linoleic acid metabolism
    103083784 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    103083784 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083784 (PLA2G4E)
   04014 Ras signaling pathway
    103083784 (PLA2G4E)
   04370 VEGF signaling pathway
    103083784 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    103083784 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103083784 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103083784 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    103083784 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    103083784 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083784 (PLA2G4E)
   04913 Ovarian steroidogenesis
    103083784 (PLA2G4E)
   04921 Oxytocin signaling pathway
    103083784 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103083784 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    103083784 (PLA2G4E)
   04726 Serotonergic synapse
    103083784 (PLA2G4E)
   04730 Long-term depression
    103083784 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103083784 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103083784 (PLA2G4E)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103083784 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2 23ISL
Other DBs
NCBI-GeneID: 103083784
NCBI-ProteinID: XP_007460260
UniProt: A0A340XMM5
LinkDB
Position
Un
AA seq 883 aa
MTLQTSEGHPGSGTDVFVLQSLQGDGEGSTAGRSVSELEQTQVLETPHLPPLLPMAPGGS
QEELSPCHLLTVRVIRMKNVRLGDVVSQTDCFVSLWLPTSSHKRLRTRTISNCRNPEWNE
SFKFQIQTQVKNVLELSICDEDTVTPDDHFLTVLYDLTKLCFREKTHVKFPLNTEGMEEL
EVEFLLEESPSPPESLITNGVLVSRQMSCLEVHAESRRQKNRKKKGLLVTVTESFEHTQH
ISHCLEPCGPNPACFHYPKYFQPQVHVEVPKSQWSSVLLCRSACKNGPVCRTLDCLADGQ
AVTLPVNKNCELHMKSAPCSEALDVRLGFSLCQAELEFLQKRRVVVAEALKQVLQLEEDL
QADEVPLISIMATGGGTRSMTAMYGHLLGLQKLNILNCASYITGLSGATWTMATLYRDPD
WSSKNLELAILEARRHVVKDKMPALFPDQLLKFQEELQQRRQEGYKVTFTDFWGLLVEAC
LGDERYECKLSDQSAALCQGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGLQKYGAF
IPTELFGSEFFMGRLMRRIPESRMCYMLGLWSSIFSLSLLDAWNLSHTSEEFFHRWTRER
VHDIEDEPLLPEIPKCDANMLDTTVVMPGSWLSNTFRNILTSRAFVSEFHNFLLGLQLHT
DYYQNGQFSTWKDSVLDGFPNKLTASVNHLCLLDTAFVINSSYPPILRPERKADLIIHLN
YCAGSQTKPMKQTCKYCTEQNIPFPKYEVQEEEDNLKECYLLESSQEPDVPTVIFFPLIS
DTFQKYKAPGVERSPEELEQGQVDLYGPKSPYATKELTYTEAAFDKLVKLSEYNILNNKD
KLLQALQLAVEKKKRLKSQCPPKSQDTPKESPLKSQDNGITYF
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgactctccagacctcagaaggccatcctggctcgggaactgatgtgtttgtcctgcag
agcctacaaggggatggagaaggcagcacagcaggaaggagtgtcagtgagttggagcag
acacaggtcttggaaactccccatctcccacctctacttcccatggcccctgggggctct
caggaggagctgtctccctgccacctgctgacagtgagggtcatccggatgaaaaacgtc
cgactgggtgatgtggtaagccagacagactgctttgtgagcctctggctgcccaccagc
tctcataagaggctgaggactaggaccatctccaactgccgaaacccagagtggaatgaa
agcttcaagttccagatccagacccaggtgaagaacgtgctagagctgagcatctgtgat
gaagacacggtgacaccagatgaccatttcttgacagttctctatgacctcaccaagctc
tgcttccgagagaaaacccacgtgaagttcccactcaacacagagggcatggaggagctg
gaggtggagttcctgctggaggagagcccctctccacctgagagtctcatcaccaatggc
gtgctggtgtctcgacaaatgtcctgcctggaggttcatgcagaatccaggagacagaag
aataggaaaaagaagggcctcctggtgacagtgacggagtccttcgagcacacccagcac
atctcacactgcctggagccctgcggcccaaaccctgcctgcttccactaccccaagtac
ttccagccccaggtccacgtggaggtgcccaagagccagtggagctctgtgcttttgtgc
cgcagtgcgtgcaagaacggccctgtgtgccggaccctggattgcctcgctgacggccag
gcggtgaccctgcctgtgaacaagaattgtgaattacacatgaagtctgcaccctgctca
gaggcactggacgtgcggctaggcttcagcctgtgccaggcagagctggagttcctgcag
aagcggagggtggtggtggctgaggcgctgaagcaggtgttgcagctggaggaggacctg
caggcagatgaggtcccactgatatccatcatggccactgggggtgggacaagatccatg
actgccatgtatggccacctgctggggctgcagaagctgaacatcctgaactgtgccagc
tacatcactggcctgtctggggccacctggaccatggctaccttgtaccgcgaccctgac
tggtcctccaaaaacctggagcttgccatcctcgaggcgcggaggcacgtagtcaaggac
aagatgcccgctctgttcccagatcagctcctcaaattccaggaggagctgcagcagcgc
aggcaggaaggctacaaagtcaccttcacagacttctggggtctgctggtcgaggcctgt
ctgggggacgagagatatgaatgcaaactgtcagatcagagtgctgctttgtgtcagggc
cagaaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccaggat
ttcagagagtggttcgagttctccccctacgaggtgggcctgcagaagtatggagccttc
attcccaccgagctcttcggctccgagttcttcatggggcggctgatgaggaggatccca
gagtcgcggatgtgctacatgctaggtctgtggagcagcatcttctccctgagcctgctc
gatgcctggaatttgtcccacacctcggaggagtttttccacaggtggacaagggagaga
gtgcatgatatcgaagatgagccactcctacctgaaatccccaaatgtgatgccaacatg
ctggacaccacggtggtgatgccagggtcatggctgtccaatacattccgcaacatcctc
acctcccgggcctttgtgtccgagttccacaacttcctgctggggctgcagctgcacacc
gactactaccagaatggccagttctccacgtggaaggactcggtgctagatggcttccca
aacaagctgacagcgtctgtgaaccacttgtgcctgctggacactgcattcgtcatcaac
tccagctacccgcccatcctcaggccggagagaaaagctgacctcatcatccacctcaat
tactgtgctgggtcccagacaaagcccatgaaacaaacctgcaagtactgcaccgagcag
aacatccccttccccaaatatgaggtgcaggaggaggaggataacctcaaggagtgctac
ctgctagagagctcccaggagcccgatgtccccactgtgattttcttcccactcatcagc
gacaccttccaaaagtacaaggccccaggtgtggagcgaagccccgaggagctggagcag
ggccaggttgacctctatggtcccaaatctccctacgccaccaaggagctgacgtacacg
gaggccgccttcgacaagctggtgaaactctccgaatataacatcctgaataacaaggac
aagctccttcaggccttgcaactagcagtagagaagaagaaacgcctgaagagccagtgt
cccccaaagtcccaggacacccctaaagagtcccccctgaagtcccaggacaatggtatt
acttatttctaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103089071
Entry
103089071         CDS       T03090                                 

Gene name
PLA2G4A
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve00590  Arachidonic acid metabolism
lve00591  Linoleic acid metabolism
lve00592  alpha-Linolenic acid metabolism
lve01100  Metabolic pathways
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04072  Phospholipase D signaling pathway
lve04217  Necroptosis
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04611  Platelet activation
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103089071 (PLA2G4A)
   00565 Ether lipid metabolism
    103089071 (PLA2G4A)
   00590 Arachidonic acid metabolism
    103089071 (PLA2G4A)
   00591 Linoleic acid metabolism
    103089071 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    103089071 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103089071 (PLA2G4A)
   04014 Ras signaling pathway
    103089071 (PLA2G4A)
   04370 VEGF signaling pathway
    103089071 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    103089071 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103089071 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103089071 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    103089071 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    103089071 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103089071 (PLA2G4A)
   04913 Ovarian steroidogenesis
    103089071 (PLA2G4A)
   04921 Oxytocin signaling pathway
    103089071 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103089071 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    103089071 (PLA2G4A)
   04726 Serotonergic synapse
    103089071 (PLA2G4A)
   04730 Long-term depression
    103089071 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103089071 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103089071 (PLA2G4A)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103089071 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 103089071
NCBI-ProteinID: XP_007451214
UniProt: A0A340WVV2
LinkDB
Position
Un
AA seq 749 aa
MSFIDPYQHIIVEHHYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRT
KHFNNDINPVWNETFEFILDPNQDNVLEITLMDANYVMDETLGTAIFPVSSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSSPDLRFSMALCDQEKAFRQQRKENIKENMKKLLGPKNNEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKSVSHNPLLLLTPQKIKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTGQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEEAEREYQNDNQASWVQRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPMSPLRDFTTQQSLEEDELDAAVADPDEFEQIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLSFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVPRETK
EEKELADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKNAIVESIEYRR
QNPSRCSVSLSSVEARRFFNKEFLSKPTA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccattattcccacaagttc
acagtagtggtgttacgtgccacaaaagtgacaaagggggccttcggtgacatgcttgac
actccagacccctatgtggaacttttcatctcctcaacccctgacagcaggaagagaaca
aaacacttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggacaatgttttggagatcacgttgatggatgccaattacgtcatggatgaa
acgctcgggacagcaatatttcccgtatcttctatgaaagtgggagagaagaaagaggtt
ccttttattttcaaccaagtcactgaaatgattctggaaatgtctcttgaagtttgttca
tccccagacctccgatttagtatggctctgtgtgaccaggagaaagctttccgacaacag
agaaaagaaaacataaaggaaaacatgaagaaactcctgggtccaaagaataatgaaggc
ttgtattctacgcgtgatgtgcctgtggtggccatactgggctcaggtggggggttccga
gccatggtaggattctccggtgtgatgaaggcactgtatgaatcaggaattttagattgc
gctacctacattgctggtctttctggatctacgtggtacatgtcaactttatattctcac
cctgattttccagagaaagggccagaggagattaatgaagagctaatgaaaagtgttagc
cacaaccctcttttacttctcacaccacagaaaattaaaagatacgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaatccacaatagaatgaacactaccttgagtagtttgaaggaaaaagtcaat
actggacagtgccctttgcctcttttcacctgtctccatgtcaaacccgatgtctcagag
ctgatgtttgcagattgggttgaatttagtccatatgagattggcatggctaaatatggt
acttttatggctcctgacttatttggaagtaaattttttatggggacagttgtaaagaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctgggggagtgccttttctatattg
ttcaacagagtcttgggagtttctggctcacaaagtaaaggttccacaatggaagaagaa
ctagaaaatattacagcaaagcatattgtgagtaatgatagctcggatagtgatgatgaa
tcacaagaacccaaaggcactgaaaatgaagaagcagaaagggaatatcaaaatgataat
caagcaagttgggtccagcgtatgataatggccttggtgagtgactcagctttgtttaat
accagagaaggacgagctgggaaggtgcacaacttcatgctgggcttgaatctcaataca
tcctatccgatgtctcctttgagagactttaccacccagcagtccttggaggaagatgaa
ttggatgcagctgtagcagatcctgatgaatttgagcagatatatgagcctctggatgtc
aaaagtaaaaagattcatgtggtggacagtggcctcacatttaacctgccataccccttg
atcctgagacctcaaagaggagttgacctcatcatctcctttgacttttctgcaaggcca
agtgattccagtcctcccttcaaggaacttctacttgcagaaaagtgggctaaaatgaat
aagctctcctttccaaagatcgatccttatgtgtttgatcgagaaggactgaaggaatgc
tatgtctttaaacccaagaatcctgatgttgagaaagattgcccaactatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggtgttccaagagaaactaag
gaagagaaagaactagctgattttgatatttttgatgaccctgaatcaccattttcaacc
ttcaactttcaatacccaaatcaagcattcaaaaggctgcatgatctgatgtacttcaat
accctgaacaacatcgatgtaataaagaatgccatagttgaaagcattgaatatagaaga
cagaatccatctcgttgctctgtttccctcagtagtgttgaggcaagaagattcttcaac
aaggagtttctaagcaaacccacagcatag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090681
Entry
103090681         CDS       T03090                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve00590  Arachidonic acid metabolism
lve00591  Linoleic acid metabolism
lve00592  alpha-Linolenic acid metabolism
lve01100  Metabolic pathways
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04072  Phospholipase D signaling pathway
lve04217  Necroptosis
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04611  Platelet activation
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103090681 (PLA2G4F)
   00565 Ether lipid metabolism
    103090681 (PLA2G4F)
   00590 Arachidonic acid metabolism
    103090681 (PLA2G4F)
   00591 Linoleic acid metabolism
    103090681 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    103090681 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103090681 (PLA2G4F)
   04014 Ras signaling pathway
    103090681 (PLA2G4F)
   04370 VEGF signaling pathway
    103090681 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    103090681 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103090681 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103090681 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    103090681 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    103090681 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103090681 (PLA2G4F)
   04913 Ovarian steroidogenesis
    103090681 (PLA2G4F)
   04921 Oxytocin signaling pathway
    103090681 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103090681 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    103090681 (PLA2G4F)
   04726 Serotonergic synapse
    103090681 (PLA2G4F)
   04730 Long-term depression
    103090681 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103090681 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103090681 (PLA2G4F)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103090681 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 103090681
NCBI-ProteinID: XP_007460206
UniProt: A0A340XFF3
LinkDB
Position
Un
AA seq 849 aa
MLWALWPRWLTGKELPLVGAVLLQKRQKREPQWRRWRRETHPYYDLQVKVLRARNIRGAD
LLSKADCYVQLWLHTASPSPAQTRVVANCHDPEWNETFHYRVHGAVKNVLELTLYDKDVL
DSDQLSLLLFDLRSLKPHQPHRHTFPLSHQDSQELQVEFVLEDSQVPASEVITNGVLVAQ
PCLRIQGTLRGDGTAPHQEYGSRQIRLAVPGAYEKPQLLPLQPPLEAGLPATFTFHVNPV
LSSRLEVELGEKLTVLQSSPSAELEVQTSKLGEAGILLSSLALGREQQHVVALGEGQEVA
MSVKAEVSSGDLDLRLGFDLCDGEQEFLDKRKHVVSKALQQVLGLSQAPDSNQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGVLDAVTYLSGVSGSTWCISTLYKDPGWSQVALKGPIE
RAQARVCSSKMGAMSRERLKYYAQELGMRESRGHSASLVDLWGLLIEYFLYQGENPAKLS
DQQEAVSQGQNPYPIYASVNVCSNISGKDFAEWCEFTPHEVGLPKYGAYVPTELFSSEFF
MGRLLQLRPEPRICYLQGIWGSAFAASLDEIFLKTTGSGLGFLQRCRGSVNITDDHQKLQ
LHDPARLQTRLFTPQGPFSQAVLDIFTYRFTSAPNSNFTQGLCLHKDYVSGREFLAWKGS
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLSLQPQRAVDLILSFDYSLDAPFEVLQMTR
KYCLDRGISFPSTEVPPEDVKEPRECYLFAKAEDLRSPIVLHFPLVNRTFRTHLAPGVER
QTDEEKACGDFVINGPDTPYGMMNFTYQPQEFERLVALSRYNVLNNVETVRQALRLALGQ
RQAGDRAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcgctctggcccaggtggctgacaggcaaggagctgcctctcgtgggtgcg
gtgttgctgcagaagagacagaagagggaacctcagtggaggcggtggcggcgggagacc
cacccatactatgacctccaggtgaaggtgctgagggccagaaatatccggggcgcagat
ctgttgtccaaagcagactgctacgtgcagctgtggctgcacacagcgtcccccagcccg
gcccagacaagggtggtagccaactgccatgaccctgaatggaacgaaaccttccactac
cgggtccacggtgccgtgaagaacgtcctggagctcaccctctacgacaaggacgtcctg
gacagcgaccagctctccctgctgctgtttgacctgaggagcctcaagccccaccaaccg
cacagacacaccttcccactcagccaccaggattcacaagagctgcaggtggaatttgtt
ttggaggacagccaggtgccggcgtctgaagtcatcaccaatggggtcctggtggctcaa
ccatgtctgagaatccagggcaccctcaggggagatgggacagccccacatcaagagtat
ggctccaggcagattcggctggcagtgcctggggcctacgagaagccccagctcttgccc
ctgcagcctcccctggaggcaggcctcccagccacgtttaccttccacgtgaacccggtg
ctcagttccaggctggaggtggagctgggagagaagctcacggtcctgcagagcagccca
agtgctgagctggaggtccagaccagcaagctgggcgaggcgggcatccttctctcctct
ctggccctaggtcgggagcagcagcatgtcgtggccctgggggagggccaggaggtggcc
atgagtgtgaaggcagaagtgagctctggggacctggacctgcgtcttggctttgacctc
tgtgacggggaacaggagtttctggataagaggaagcacgtcgtgtccaaggccctacag
caggtgctgggattgagccaggctcccgacagtaaccaggtgcctgtggtggccgtgctg
ggttcgggaggtggaacccgagccatgtcttccctctacggcagcctggccgggctacag
gagctcggcgtcctggacgctgtgacctatctgagtggagtctctgggtccacctggtgc
atctccacgctctacaaggacccaggctggtcgcaggtggccttgaagggccctattgag
cgcgcccaggcgcgggtctgcagcagtaagatgggggcaatgtccagggaacgcctgaag
tactatgcccaggagctggggatgcgggaaagcaggggccacagcgcttccctcgtcgac
ctctgggggcttctcattgaatatttcctataccagggggaaaatcctgccaagctgtct
gaccagcaggaggcggtcagccagggccagaacccttaccccatctacgccagtgtcaac
gtctgcagcaacatcagtgggaaagactttgcagagtggtgcgagttcaccccccatgag
gtcggcttacccaagtatggcgcttatgttcccactgagctctttagctcagagttcttc
atggggcgactgctgcagctccgccccgagccccggatttgctacctgcagggtatatgg
ggcagcgcgtttgcagccagcctggatgagatcttcctgaagaccaccggctcaggtctt
ggcttcctacagaggtgcagaggcagtgtaaacatcacagacgaccaccagaagctccag
ctgcacgacccagcgaggctgcaaaccaggctcttcaccccgcaagggcccttctcccag
gctgtgctggacatattcacctaccgctttacctcagccccgaactcgaacttcacccag
ggcctctgcctgcacaaggactatgtgtctggcagggagtttttggcctggaaaggttcg
cacccggatgccttccccaaccagctcactcccatgcgggactgtctgtacctggtggat
ggaggctttgccatcaactctccgttcccgctgagcctgcagccgcagagagccgtggac
ctcattctgtccttcgactactccctggatgccccttttgaggtcttacagatgacacgg
aagtactgcctggaccgaggcatctccttccccagcactgaggtgccccctgaggacgtg
aaggagccccgtgaatgctacctgtttgccaaggccgaggacctgcgctcacccatcgtg
ctgcacttccccctggtcaaccgtaccttccgcacacacctggccccaggtgtggaacga
caaacggatgaggagaaagcctgtggcgactttgtcatcaatgggccagacaccccctat
ggcatgatgaacttcacctaccagccccaggagtttgagcggctggtggcgctgagtcga
tacaacgttctgaacaacgtggagactgtgcggcaggccctccggctggctctgggccag
cgacaggctggggacagggctggaggctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090934
Entry
103090934         CDS       T03090                                 

Gene name
PLA2G4B
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve00590  Arachidonic acid metabolism
lve00591  Linoleic acid metabolism
lve00592  alpha-Linolenic acid metabolism
lve01100  Metabolic pathways
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04072  Phospholipase D signaling pathway
lve04217  Necroptosis
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04611  Platelet activation
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103090934 (PLA2G4B)
   00565 Ether lipid metabolism
    103090934 (PLA2G4B)
   00590 Arachidonic acid metabolism
    103090934 (PLA2G4B)
   00591 Linoleic acid metabolism
    103090934 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    103090934 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103090934 (PLA2G4B)
   04014 Ras signaling pathway
    103090934 (PLA2G4B)
   04370 VEGF signaling pathway
    103090934 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    103090934 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103090934 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103090934 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    103090934 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    103090934 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103090934 (PLA2G4B)
   04913 Ovarian steroidogenesis
    103090934 (PLA2G4B)
   04921 Oxytocin signaling pathway
    103090934 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103090934 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    103090934 (PLA2G4B)
   04726 Serotonergic synapse
    103090934 (PLA2G4B)
   04730 Long-term depression
    103090934 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103090934 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103090934 (PLA2G4B)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103090934 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 103090934
NCBI-ProteinID: XP_007460207
UniProt: A0A340XJC0
LinkDB
Position
Un
AA seq 780 aa
MALAKVPGTCLLSIHVLQARGLPSKDLVTPSDCYVTLWLPSASSPQLQTRVVKNSRNPIW
NQSFHFRIHSQLKNIVQFKVFDQDLLTKDDPLLSVLFDVGTLQAGEPWRESFSLSPQGKE
QLEVEFRLQNLTDCAERLVSNGILVARELSCLHVRLEKAGGQQGSEGRVQLVVPGSCEGP
QEASVGAGSFRFHWPACWEQELSVHLQDAPQEQLQVPLRALPSDQVVRLVFPTSQEPLMK
VELKKEGLRELAVRLDCGPCAEERAFLSRRKQVVAKALKRALQLDGDLQEDEIPVVAVMA
TGGGIRAMTSLYGQLAGLKELGLLDCISCITGASGSTWALANLYEDPEWSQKDLAGPIQS
LKTQVTKSKLGVLAPSQLWRYRQELAERACLGHPTCFTTLWGLINEALLHDEPHDHKLSD
QREALSRGQNPLPIYCALNTKERNLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFF
MGRLTKRLPESRICFLEGIWSNLYAASLQDSLYWSSEPSQFWDHWAQAQASLDKEQVPLL
NIEEPPTVASRIAEFFTDLLTWRPLAEATHNFLRGLSFHKDYFQHPHFSAWKATKLDGLP
NQLTPAEPFLCLLDVGYLVNTSCPPLLRPTRDVDLILSLDYNLHGAFQQLQLLDRFCQEQ
GIPFPSISPSPEEQRQPRECHLFSDPARPDAPAVLHFPLVNASFREYSAPGVRRTAEAQE
AGEVNLSSSDSPYHYLKVTYSREDVDKLLHLTHYNICNNQEQLLEALREAVRRRKQRRAE
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggctctggcaaaggtgcctgggacctgcttgctcagcattcatgtcctgcaggcccgt
ggcctgccctccaaggacctagtgaccccctctgactgctacgtgactctgtggctgccc
tcggcctccagcccccagctccagacgcgcgtggtcaagaacagcagaaaccccatctgg
aatcagagctttcacttccgaatccacagccagctcaagaacatcgtgcaattcaaagtc
tttgaccaggaccttctgaccaaggatgaccctctgttgtcggtgctgtttgacgtgggg
actttgcaggctggggagccctggcgtgagagcttctcactgagccctcagggcaaggag
cagctggaagttgaatttcggctgcagaatctgaccgactgtgctgagcgcctcgtcagt
aatggcatcctggtggcccgggagctctcctgcttgcatgttcgactggagaaggccggg
ggccagcaggggtcggagggcagagttcagcttgtggttcccgggtcctgtgagggtccg
caggaggcctccgtgggcgctggctccttccgcttccattggccggcctgctgggagcag
gagctgagtgttcacctgcaggatgcgccccaagagcagctgcaggtgcctctgagggca
ctgccctctgaccaagtggtgagacttgtcttccctacatcccaggagcccctgatgaag
gtggagctgaaaaaagaaggactgagagagctggcggtgcggctggactgcgggccctgt
gccgaggagcgggccttcttgagcaggaggaagcaggtggtggccaaggccctgaagcgg
gccctgcagctggatggagacctgcaggaggatgagatcccagtggtagctgttatggcc
acgggtggtgggatccgggccatgacttccctgtatgggcagctggctggcctgaaggag
ctgggcctcttggattgcatctcctgcatcacaggggcctcgggctccacctgggctttg
gccaacctctatgaggacccagagtggtctcagaaggacctggcagggcccatccagtca
ctgaagacacaggtgaccaagagcaagctgggcgtgctggcccccagccagctgtggcgg
taccggcaggagctggctgagcgtgcatgcctgggccacccgacctgcttcaccaccctg
tggggcctcatcaacgaggcgctgttgcatgacgagcctcacgaccacaaactctcagac
cagcgggaggccctgagccgtggccagaaccctctgcccatctactgtgctctcaatacc
aaagaacggaacctgactacctttgaatttggggagtggtgtgagttctccccctatgag
gtcggctttcccaagtacggcgccttcatcccctctgagctcttcggctccgagttcttc
atggggcgcctgacaaagcggcttcctgagtcccgcatctgcttcctggaaggcatctgg
agcaacctgtacgcagcgagcctccaggacagcttgtattggtcctccgagcccagccag
ttctgggaccactgggcacaggcccaggccagcctggacaaggagcaggtcccccttctg
aatatagaagagcctcccacagtggccagcagaatagctgagttcttcactgaccttctg
acatggcgtccacttgccgaggccacccacaatttcctccgtggcctctctttccacaag
gactatttccagcatcctcacttctctgcctggaaagccaccaaactggatggcctcccc
aaccagctgacacctgcagaacccttcctttgcctgttggatgttggctaccttgtcaac
accagctgcccacccctcctgcggcccacacgggacgtggacctcatcctgtcgctggat
tacaacctccatggagcctttcagcagctgcagctcctggatcggttctgccaggagcag
ggcatcccattcccgtccatctcacccagccccgaggagcagcgccagccccgggagtgc
cacctcttctcagaccctgcccgccctgacgcccctgccgtgctgcacttcccgctggtc
aatgcctccttccgggagtactcagccccaggggtccggcggacggccgaggcgcaggag
gccggggaggtgaacctgtcttcatccgactccccctaccactacttgaaggtgacttac
agccgggaggacgtggacaagctgctccacctgacgcactacaacatctgcaacaaccag
gagcagctgctggaggccctgcgtgaggctgtgcggcggcgcaagcagcgccgggccgag
tga

DBGET integrated database retrieval system