KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083525Help
Entry
103083525         CDS       T03090                                 

Definition
(RefSeq) uncharacterized LOC103083525
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-GeneID: 103083525
NCBI-ProteinID: XP_007446635
UniProt: A0A340WHY2
LinkDB All DBs
Position
Un
AA seq 985 aa AA seqDB search
MAKRTRPAAFIDDPLWYKDAVIYQLHIKSFFDANNDGIGDFAGLISKLDYIADLGAHKRG
LRVITELVINHTSDQHPWFQRARHAKRGSKARDFYVWSDDDHKYDGTRIIFLDTEKSNWT
WDPVAGQYFWHRFYSHQPDLNFDNPQVLKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGT
NNENLPETHDVLKAIRAEIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLM
PRMYMALAMEDRFPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAE
DRRARINLGIRRRLAPLLQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDG
VRTPMQWSPDRNGAQSHDPHSLLNWTRRLLAVRKQQKAFGRGTLRTLTPSNRRILAYIRE
FTDADGHTEVILCVANVSRAAQAAELDLSQYADKVPVEMIVLRKRLEELLESPSRDALQS
TILPQYLPKRRWFAGKEGPVDQVDLSYGVRMATAGMPVLFSEIEVTSDGVTSRYQLPFGL
LPEEQISTALPQQLALSRVRRANEVGLITDAFVLEPFIRAVLKACQEGVRLTCGNDQGEL
HFNHTEQLAGLALGDDSSVRYLSAEQSNSSVVVGDSVVLKLIRRVNAGIHPELEMSAYLT
AAGFANISPLLAWVSREEAQGAPHLLMIAQGYLSNQGDAWAWSQNTLERAIRDQMQPSSA
EGEPHTDAVSELRDFASLLGQRLGEMHLMLAAPTENQAFAPYPSTDADSERWSAQISTEL
THALDLLVQHRDKLDPESQALVDDLQQQRDGLAQRVAELARQAQGGLLMRVHGDLHLGQV
LVVQGDAYLIDFEGEPSRPLEERRAKHSPYKDVSGVLRSFDYAAAMILRSASTMDLSEPA
RQARQRVARQYLHQSRHAFIEAYGLATAAMPHAWEQAEGERAALELFCLEKAAYEITYEA
ENRPSWLAVPLHGLHGLISTWGESE
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtacccgcccggcagccttcattgacgacccgctgtggtacaaggatgcg
gtgatttaccagttgcacatcaagtcgttcttcgatgccaacaatgacggtatcggtgac
ttcgccgggttgatcagcaagctcgactacatcgccgacctgggcgcgcacaaacgcggg
ctgcgggtgattaccgaactggtcatcaaccacaccagcgaccagcacccgtggtttcaa
cgtgcccgccatgccaagcgtggcagcaaggcccgcgacttctacgtgtggtccgatgac
gaccacaagtacgacggcacccgcatcatcttcctcgataccgagaaatccaactggacc
tgggacccggtggcaggccagtacttctggcaccgcttctactcccatcagccggatttg
aatttcgacaatccgcaggtgctcaaggccgtgatcggcgtgatgcgcttctggctggac
ctgggtgtcgatggcttgcggcttgacgccatcccgtacctgatcgagcgcgacggtacc
aacaacgagaacctgcccgaaacccatgatgtgctcaaggcgatccgggccgagatcgat
gccaattaccctgatcgcatgttgctcgccgaggccaaccagtggccggaggatacccgc
ccttactttggcgaaggcgacggggacgaatgtcacatggcgttccattttccgctgatg
ccacgcatgtacatggcgcttgccatggaagatcgctttcccatcaccgacatcctgcgc
cagaccccggagattccggccaactgccagtgggccatcttcctgcgcaaccacgatgag
ctcaccttggagatggtcaccgaccgcgagcgcgactacctctggaactactacgccgag
gaccgccgcgcccggatcaacctaggcatccggcgccgcttggcgccgctgctgcaacgc
gaccggcgcaggatcgagctgctcaccagcctgctgctctcgatgccaggtacgccaacg
ctgtattacggcgatgagctgggcatgggcgacaacatctacctgggcgatcgcgacggc
gtgcgcacgcccatgcagtggtcgcctgaccgcaacggcgcacagagccacgatcctcat
tcattgctgaactggacgcgtcgcctgctcgccgtgcgcaagcagcaaaaagccttcggc
cgtggcacgctgcgcacgctgacacccagcaaccgacgcatccttgcctacatccgggaa
ttcaccgacgccgatggccacaccgaggtgattctctgtgtcgccaacgtgtcccgggcg
gcccaggctgcggaactggatttgtcccagtacgccgacaaggtccccgtggaaatgatc
gtgctacgcaaacgtcttgaagagctgctcgagtcgccttcacgcgacgccttgcagtcc
accatcctgccccagtatttgcccaagcgacgctggttcgcgggtaaggaagggcctgtc
gatcaggtcgacctgagctatggcgtgcgcatggccacggccggtatgcccgtgctgttc
agtgaaatcgaggtgaccagcgacggggtgaccagccgctaccagctaccgttcggcttg
ctgcccgaagagcaaatcagcacggctctgccgcagcagttggccttgtcgcgcgtgcga
cgggccaatgaggtgggcctgatcaccgatgccttcgtcctcgaacccttcattcgtgcg
gtgctcaaggcctgccaggagggcgtgcgcctgacctgcgggaacgaccagggcgaactg
catttcaatcacaccgagcagctggctggcctggcactgggcgatgacagctcggtgcgc
tacctgagcgccgagcagtccaacagttcggtagtggtgggcgattcggtggtgctcaag
ttgatccggcgggtcaacgcaggcattcacccagagcttgaaatgagcgcttatctcacc
gctgcgggcttcgccaatatctcgccgttgctggcctgggtcagtcgcgaggaggcccaa
ggcgcgccacacctgttgatgattgcccagggctatctgagtaatcagggcgatgcctgg
gcctggtcccagaacaccttggagcgcgccattcgcgaccagatgcagccctccagtgcc
gaaggcgaaccccataccgacgcggtcagcgaactgcgcgacttcgcttctttgctgggt
cagcgcctgggcgagatgcacctgatgctcgccgcacctaccgagaaccaggccttcgcg
ccttatcccagcactgacgctgacagcgagcggtggagtgcgcagatcagcacggagctg
acccacgcgctggatctgctggtgcagcaccgtgacaaactcgaccctgaaagccaggcg
ttggtcgatgacttgcagcagcagcgcgacgggctcgcccaacgcgtggcagaacttgca
cggcaggcgcagggtgggctgttgatgcgcgtgcatggcgaccttcacctgggccaagtg
ctggtggtgcaaggcgatgcctacctgatcgacttcgagggggaaccgtcccgaccactg
gaagagcgccgggccaagcacagcccgtacaaagatgtcagcggtgtgttgcgctctttc
gactatgctgctgcgatgatcctgcgcagcgcgtctacgatggacctttccgagccggcg
cgacaagctcggcagcgggtggcccgacagtaccttcaccagtccaggcatgcgttcatc
gaggcttatggcctggccaccgcggccatgccccacgcctgggagcaagccgaaggcgag
cgtgcggcacttgagctgttctgcctggaaaaagcggcatacgaaataacttatgaagcc
gaaaatcgtccaagctggctggccgtgcctttgcatggcctgcatggactgatcagtacc
tggggagagtcagaatga

DBGET integrated database retrieval system