KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083902
Entry
103083902         CDS       T03090                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103083902
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 103083902
NCBI-ProteinID: XP_007447095
UniProt: A0A340WJB6
LinkDB
Position
Un
AA seq 82 aa
MRCLASLALALLALKAALMLAPALTLPVPVPKAGRCPRVQAPLAPKLCLERNKCSRDDQC
MENRKCCFSSCAMRCMVPATGP
NT seq 249 nt   +upstreamnt  +downstreamnt
atgcgttgtcttgccagcctggccctggccctgctcgccctgaaggctgccctcatgctg
gccccggccctcaccttgccagtacctgttccaaaggctggccgctgtccccgggtgcag
gccccgctggccccaaagctctgcttagagagaaacaagtgctccagggatgaccaatgt
atggagaaccggaagtgctgcttcagctcgtgtgccatgaggtgtatggtccctgccaca
ggtccatga

DBGET integrated database retrieval system