KEGG   Lipotes vexillifer (Yangtze River dolphin): 103084996Help
Entry
103084996         CDS       T03090                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00500  Starch and sucrose metabolism
lve01100  Metabolic pathways
lve04151  PI3K-Akt signaling pathway
lve04152  AMPK signaling pathway
lve04910  Insulin signaling pathway
lve04922  Glucagon signaling pathway
lve04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103084996 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103084996 (GYS1)
   04152 AMPK signaling pathway
    103084996 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103084996 (GYS1)
   04922 Glucagon signaling pathway
    103084996 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    103084996 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lve01003]
    103084996 (GYS1)
Enzymes [BR:lve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103084996 (GYS1)
Glycosyltransferases [BR:lve01003]
 Polysaccharide
  Storage polysaccharide
   103084996 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103084996
NCBI-ProteinID: XP_007463395
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWDDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREGNDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRGLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEQFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGGSKRGSVDTAPSSSVS
TPSEPLSPSSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctcactgccaggactggaggattgggacgat
gaattcgacctggagaacacagtgctttttgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccgaccccagccctgaagaggactctggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgaggggggccccctggtggtgctcctcgacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacgtgcaacatcggg
gtgccctggtatgaccgggaaggcaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacatgtggttgcacacttccat
gagtggttggcgggcatcgggctctgcctatgccgtgcccggcggctgcctgtggctacc
atcttcacgacccacgccacgctgctggggcgatacctgtgtgccggtgccgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcggcagcccactgcgctcatgtcttcactaccgtgtcccag
attaccgccattgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttatcgctggccgctatgaattctccaacaagggggccgat
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acagtggttgccttcttcatcatgccagctcggaccaacaatttcaacgtggaaaccctt
aagggccaagccgtgcgcaagcagctttgggatacggccaacacagtgaaggagaagttt
gggaggaagctttatgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcggcagtctttc
cctcctgtgtgcacccacaatatgctggacgactcctcagatcctattttgaccaccatc
cgccgaattggcctcttcaatagtagtgccgacagggtcaaggtgatttttcacccggag
ttcctctcctctacgagccccctgctccctgtggactatgaggagtttgtccgtggctgc
cacctgggcgtcttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gttatgggtatccccagtgtctccaccaacctttctggtttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacattctggaccggcgtttccgaggcctg
gatgattcttgctcgcagctcacctccttcctctacagtttctgccagcagagccggcgg
cagcgcattatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactacatgtctgcgcgccacatggcgctggccaaggcctttccagaacag
ttcacctacgagccccacgaggctgacgcgacccagggctaccgctacccgcggccagcc
tcagtgccaccgtcgccctcactgtcgagacactccagcccgcaccagagcgaggatgag
gaggagccccgggacggaccacccgatgaagatggcgagcgctacgacgaggacgaggag
gctgccaaggaccggcgcaacatccgcgccccggagtggccacgccgcgcctcctgcacg
tcttcaaccggcgggagcaagcgcggctcggtggacacagcgccctccagctcagtcagc
acccccagcgagcccctcagcccctccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system