KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085144Help
Entry
103085144         CDS       T03090                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 103085144
NCBI-ProteinID: XP_007453976
UniProt: A0A340WY33
LinkDB All DBs
Position
Un
AA seq 372 aa AA seqDB search
MEVAQLKYLEEDFGLAKRRYAELRRQKRIFNARNRIIGGDTEAWDVQVCDQKIKEATEKA
RQETFAAEMRQNDKIACISEDRERRERKNLCKAINDFQQSFQKPETRREFDLSNPLALKK
DLPARQSDNDAWNTISGMQKFMGEDLNFYQRKKFQEEQNREWSLQQQREWKVARANQKCA
EDLYLKTRLQFDETAKHLQNLESTNRKAVCAAVKEFNKNQALESAEKKIQEKKQDQEDNL
AEISNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMSREQLEHIRLVQKQQVQEKLRLQR
DMDWDRQRVQRARAALLLERQQQRQQHDLRRALDCNNLGLAKEQLSQKKYMKEICTNHLT
EDYFAQFNTRSR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagcgcagctcaagtacctggaggaggacttcggcctggccaaaaggagatac
gcggagctgcgcaggcagaaacggatcttcaatgccaggaacaggatcatcgggggagac
acagaagcctgggacgttcaggtttgtgaccagaagataaaagaagcaactgaaaaagct
agacaggaaacctttgctgctgaaatgaggcaaaatgacaagatcgcatgcatatcagaa
gaccgggaaaggagagagaggaaaaatctctgtaaagctatcaatgatttccaacagagc
tttcagaagccagaaactcgccgtgaatttgacctctccaaccccctagcccttaagaaa
gatcttccagcccggcagtcagataatgatgcttggaatacaatatcaggaatgcagaaa
ttcatgggagaggatttaaacttctatcagaggaagaaattccaagaggaacaaaacagg
gaatggtccttgcaacagcaaagggaatggaaggttgcccgcgccaaccaaaaatgcgca
gaggatctctacctgaagacaaggctgcagtttgacgaaacagccaagcatttacagaat
ctggaaagcaccaacagaaaggcggtttgtgcagctgtgaaagaattcaacaagaaccag
gccttggagtcagcggaaaagaaaattcaagagaaaaaacaagaccaagaagacaacctg
gccgagatctccaacctgctgcgtggggacctgctctcggagaacccccagcaggcagcc
agctccttcgggccccatcgcgtggtccctgaccgctggaagggcatgagccgggagcag
ctggagcacatccgcctggttcagaaacagcaagtacaggagaagctgaggctccagcga
gacatggattgggacaggcagagggtccagcgggctcgtgccgccttgctgcttgagcga
cagcagcagcgccaacagcatgacctgcgcagagccctggactgcaacaacctcggcctg
gccaaggagcagctttcgcagaaaaaatatatgaaggaaatctgtacaaatcatctcaca
gaagattatttcgcacaatttaatacaagaagtcgataa

DBGET integrated database retrieval system