KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085238Help
Entry
103085238         CDS       T03090                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00010  Glycolysis / Gluconeogenesis
lve00051  Fructose and mannose metabolism
lve00052  Galactose metabolism
lve00500  Starch and sucrose metabolism
lve00520  Amino sugar and nucleotide sugar metabolism
lve00524  Neomycin, kanamycin and gentamicin biosynthesis
lve01100  Metabolic pathways
lve01200  Carbon metabolism
lve04066  HIF-1 signaling pathway
lve04910  Insulin signaling pathway
lve04930  Type II diabetes mellitus
lve04973  Carbohydrate digestion and absorption
lve05230  Central carbon metabolism in cancer
Module
lve_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lve_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103085238 (HK1)
   00051 Fructose and mannose metabolism
    103085238 (HK1)
   00052 Galactose metabolism
    103085238 (HK1)
   00500 Starch and sucrose metabolism
    103085238 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103085238 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103085238 (HK1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    103085238 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103085238 (HK1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    103085238 (HK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    103085238 (HK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103085238 (HK1)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103085238 (HK1)
Membrane trafficking [BR:lve04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103085238 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 103085238
NCBI-ProteinID: XP_007454631
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMARFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQKQTVHMESEVYDTPESIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGTDVVKLLEKAIKKHGDYDANVVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAREILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDTLLEVKRRMRAEMELGLGKQTHDKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPTEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGQDVATLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGNEGRMCINMEWGAFGDNGCLDD
IRTIYDKLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEPLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRQETSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcttattacttcaccgaactgaaggatgaccaagtcaaa
aagatcgacaaatatctctatgccatgcggctctctgatgaaactctgttagatatcatg
gctcgtttcaaaaaggagatgaagaatggcctctcccgggattttaatccgacagccaca
gtcaagatgttgccaacgtttgtaaggtccattcctgacggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
caaaaacagactgttcatatggagtccgaggtttacgacaccccggagagcatcatgcac
ggcagtggaagccagctttttgatcatgtcgctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtcggattcacattttctttcccttgtcggcaa
tccaaaatagatgaggccatcctgatcacctggacaaagagatttaaagcgagtggagtg
gagggaacggatgtggtgaagctgcttgagaaagccatcaaaaagcacggggactatgac
gccaacgttgtggctgtggtgaatgacactgtggggaccatgatgacctgtggctacgac
gaccagcagtgtgaagtcggcctcatcattggcacgggcaccaacgcgtgctacatggag
gaactgaggcacatcgacctggtggaaggcgacgaagggaggatgtgcatcaataccgag
tggggggccttcggggacgacggggccctggaggacatccgcactgagttcgaccgggag
attgaccggggctcactcaaccctgggaagcagctgtttgaaaagatggtcagtggcatg
tacatgggcgagctggtccgattgatcttggtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgacgtgtca
gccattgaaaagaataaggaaggcctccacaatgccagagaaatcctgacccgcctggga
gtggagccatctgatgacgactgtatttcggtccagcacgtgtgcaccattgtctcgttc
cgctctgccaacctagtggctgcgacgctgggcgccatcctgaatcgtcttcgagataac
aagagcacgcccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagaccctgaggcgcttggtgcccgactgtgatgtg
cgtttcctcctctcggagagtggcagcggcaagggggctgccatggtgaccgcggtggcc
taccgcctggctgagcagcaccggcagatagaggagaccctggcccacttccatctcacc
aaggatacgctgctggaggtgaaaaggaggatgcgggccgagatggaattggggctgggc
aagcagacgcatgacaaggccgttgtcaagatgctgccctccttcgtccggagcactccc
gatgggacagagcatggtgacttcctggccctggatcttggaggaacgaatttccgcgtc
ttgctggtgaaaattcgtagtgggaaaaagagaacagtggaaatgcacaacaagatctac
gccattcccacggaaatcatgcagggcactggggaagagctgtttgaccacatcgtttcc
tgcatctctgacttcctggactacatgggcatcaagggccccagaatgcctctgggcttc
acattttcatttccctgcaagcagacgagcttggatgcgggaatcttgatcacctggacg
aaaggttttaaggcaactgattgcgtggggcaggacgtagcgaccttactgagggatgcg
gtaaaaaggagagaggaatttgacctggacgtggtggctgtggtcaatgacacagtgggc
accatgatgacctgtgcttatgaggagcccacctgcgaggttggactcatcgtagggacg
ggcagcaatgcctgctacatggaagaaatgaaaaacgtcgagacgctagaaggaaacgag
ggccgaatgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctggatgat
atcagaacgatctatgacaaactggtggatgaatattctctaaacgccgggaagcaaagg
tatgagaagatgatcagcggtatgtacctgggtgaaatcgtccgcaacatcttgattgac
ttcaccaagaggggattcctcttccgagggcagatctctgagccgctgaagactcggggc
atctttcagaccaagtatctctctcagatcgagagcgaccgattagcgctgctgcaggtc
cgggccatcctccagcagcttggcctgaacagcacatgcgacgacagcatcctcgtgaag
accgtgtgcggggtagtgtccaagagggccgcacagctgtgtggtgcgggcatggctgcc
gtggtggacaagatccgcgagaacagggggctggaccacctcaacgtgactgtgggcgtg
gatgggacgctctacaagcttcatccgcatttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcttatccgaagacggtagcggcaaggga
gccgccctcatcacggcagtgggcgttcggctccggcaagaaacgagcagctaa

DBGET integrated database retrieval system