KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085385
Entry
103085385         CDS       T03090                                 

Definition
(RefSeq) neuroendocrine secretory protein 55-like
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04072  Phospholipase D signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05012  Parkinson disease
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05034  Alcoholism
lve05142  Chagas disease
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103085385
   04020 Calcium signaling pathway
    103085385
   04072 Phospholipase D signaling pathway
    103085385
   04024 cAMP signaling pathway
    103085385
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103085385
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103085385
  09152 Endocrine system
   04911 Insulin secretion
    103085385
   04922 Glucagon signaling pathway
    103085385
   04923 Regulation of lipolysis in adipocytes
    103085385
   04912 GnRH signaling pathway
    103085385
   04913 Ovarian steroidogenesis
    103085385
   04915 Estrogen signaling pathway
    103085385
   04921 Oxytocin signaling pathway
    103085385
   04926 Relaxin signaling pathway
    103085385
   04935 Growth hormone synthesis, secretion and action
    103085385
   04918 Thyroid hormone synthesis
    103085385
   04928 Parathyroid hormone synthesis, secretion and action
    103085385
   04916 Melanogenesis
    103085385
   04924 Renin secretion
    103085385
   04925 Aldosterone synthesis and secretion
    103085385
   04927 Cortisol synthesis and secretion
    103085385
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103085385
   04270 Vascular smooth muscle contraction
    103085385
  09154 Digestive system
   04970 Salivary secretion
    103085385
   04971 Gastric acid secretion
    103085385
   04972 Pancreatic secretion
    103085385
   04976 Bile secretion
    103085385
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103085385
   04961 Endocrine and other factor-regulated calcium reabsorption
    103085385
  09156 Nervous system
   04724 Glutamatergic synapse
    103085385
   04728 Dopaminergic synapse
    103085385
   04726 Serotonergic synapse
    103085385
   04730 Long-term depression
    103085385
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103085385
  09159 Environmental adaptation
   04713 Circadian entrainment
    103085385
   04714 Thermogenesis
    103085385
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103085385
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103085385
  09165 Substance dependence
   05030 Cocaine addiction
    103085385
   05031 Amphetamine addiction
    103085385
   05032 Morphine addiction
    103085385
   05034 Alcoholism
    103085385
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103085385
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103085385
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103085385
   05165 Human papillomavirus infection
    103085385
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103085385
   05142 Chagas disease
    103085385
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103085385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103085385
   04031 GTP-binding proteins [BR:lve04031]
    103085385
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103085385
  Exosomal proteins of other body fluids (saliva and urine)
   103085385
  Exosomal proteins of colorectal cancer cells
   103085385
  Exosomal proteins of bladder cancer cells
   103085385
GTP-binding proteins [BR:lve04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103085385
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 103085385
NCBI-ProteinID: XP_007449525
UniProt: A0A340WRC9
LinkDB
Position
Un
AA seq 242 aa
MDRRSRAQQGRRARHSYNDLCPPLGRRAATALLWLSCSIALLRALATSSARAQQRAAAQR
RSFLNAHHRSAAQVFPEPPESYHEHEEADLELSLPECLEYEEEFDYESETETESEIESET
DFQTEPETAPATEPETEPEDERGPVVAKRRTFDQSLTERLNALRLQSPDASPSRAQPSTR
ESESPRRGEEPEPEDKDPRDPEESEQPKEKQRRRRCKPKKPTRRDPSPESPSKRGPIPIR
RH
NT seq 729 nt   +upstreamnt  +downstreamnt
atggatcgcagatcccgagctcagcaagggcgccgagctcgccacagttacaacgatctg
tgcccacccctaggccgccgggcagccaccgcactcctctggctctcctgctccatcgct
ctccttcgcgccctcgccacctccagcgcccgcgcccagcagcgcgcggctgcccagcgc
cggagcttccttaacgcccaccaccgctccgccgcccaggtattccccgagccccccgaa
tcctaccacgagcacgaggaggcagacctcgagctctccctccccgagtgcctggagtac
gaggaagagttcgactacgaatccgagaccgagaccgagtctgaaatcgagtcggagacc
gacttccagaccgagcctgagaccgcccccgccactgagcccgagaccgagcccgaggac
gagcgcggccccgtggtggccaagcgccgcaccttcgaccagtctctcactgagcgtctc
aacgccctgaggttgcagagccccgacgcctccccgagtcgcgcgcagcccagcactcgg
gagtctgagagccccagacgaggggaggagcccgagcccgaggacaaggatccgagggac
cccgaggagtctgagcagccaaaggagaagcagcggcggcgccgctgcaagccgaagaag
cccacccgccgcgacccatctccggagtctccttccaaaaggggacccatccccatccgg
cgtcactaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103089051
Entry
103089051         CDS       T03090                                 

Gene name
GNAS
Definition
(RefSeq) GNAS complex locus
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04072  Phospholipase D signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05012  Parkinson disease
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05034  Alcoholism
lve05142  Chagas disease
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103089051 (GNAS)
   04020 Calcium signaling pathway
    103089051 (GNAS)
   04072 Phospholipase D signaling pathway
    103089051 (GNAS)
   04024 cAMP signaling pathway
    103089051 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103089051 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103089051 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    103089051 (GNAS)
   04922 Glucagon signaling pathway
    103089051 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    103089051 (GNAS)
   04912 GnRH signaling pathway
    103089051 (GNAS)
   04913 Ovarian steroidogenesis
    103089051 (GNAS)
   04915 Estrogen signaling pathway
    103089051 (GNAS)
   04921 Oxytocin signaling pathway
    103089051 (GNAS)
   04926 Relaxin signaling pathway
    103089051 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    103089051 (GNAS)
   04918 Thyroid hormone synthesis
    103089051 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    103089051 (GNAS)
   04916 Melanogenesis
    103089051 (GNAS)
   04924 Renin secretion
    103089051 (GNAS)
   04925 Aldosterone synthesis and secretion
    103089051 (GNAS)
   04927 Cortisol synthesis and secretion
    103089051 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103089051 (GNAS)
   04270 Vascular smooth muscle contraction
    103089051 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    103089051 (GNAS)
   04971 Gastric acid secretion
    103089051 (GNAS)
   04972 Pancreatic secretion
    103089051 (GNAS)
   04976 Bile secretion
    103089051 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103089051 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103089051 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    103089051 (GNAS)
   04728 Dopaminergic synapse
    103089051 (GNAS)
   04726 Serotonergic synapse
    103089051 (GNAS)
   04730 Long-term depression
    103089051 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103089051 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103089051 (GNAS)
   04714 Thermogenesis
    103089051 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103089051 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103089051 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    103089051 (GNAS)
   05031 Amphetamine addiction
    103089051 (GNAS)
   05032 Morphine addiction
    103089051 (GNAS)
   05034 Alcoholism
    103089051 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103089051 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103089051 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103089051 (GNAS)
   05165 Human papillomavirus infection
    103089051 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103089051 (GNAS)
   05142 Chagas disease
    103089051 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103089051 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103089051 (GNAS)
   04031 GTP-binding proteins [BR:lve04031]
    103089051 (GNAS)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103089051 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103089051 (GNAS)
  Exosomal proteins of colorectal cancer cells
   103089051 (GNAS)
  Exosomal proteins of bladder cancer cells
   103089051 (GNAS)
GTP-binding proteins [BR:lve04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103089051 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc
Other DBs
NCBI-GeneID: 103089051
NCBI-ProteinID: XP_007449536
UniProt: A0A340WLE5
LinkDB
Position
Un
AA seq 991 aa
MGVRNCLDGNNMSGQRNIPLELGEQPEQPPLEAPGAAASGAGPGAAEEMETPPPHSEPVP
VEIEGEACGPPEVSRPKFQGLSQAIKEARAHGGYSPPPEEAMPFEVEQSSLGGFWPTLEH
PGDTTGAHAGLEAFSPPIVEPRAFGEARPSLGSYSPPPEEAMPFEFEQPAQGGCSQPLLQ
VSDIAPGGPGAGVFRAPPEEPRALRPANAGFRGGCSPPPEEDVPFEFDGAAFGDDSPPPG
LPRAIPQIDGLGGNQIAAVAAPSAVLLAPAANEPPLWVPGIIGSPSREAVRPPPHFAGNS
PPMEISGPPREIGSAPVGVDDAPVNVDSPPVALDGPPIEVSRAPVKREQAEGERPPVEGE
AAEMEGGSADAAAERGKVPDAGDGAPAAGAAPDTPAPAARAAPVARAAPVARAAPVARAT
PVARAAPAAWATPASGARPKISFLRPPSPEIQAADPPTPQPPRAYAWRGRSERSCYRGDD
DDDEISVSSDSGDESDDGTFGCHRWFQSRRNRRRRKTRRNLLRNFLVQAFRGCFCRSESP
QSRGSLSPKVKKVALAEKGRQTRKESMEKRVQKRAEKKRSKLIDKQLQDEKMGYMCTHRL
LLLGRKVVPYNTEGRFQLDKPAPATVRRRRVVGWGTARKAGASGAGESGKSTIVKQMRIL
HVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPE
NQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKID
VIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTA
IIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLA
GKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHF
TCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 2976 nt   +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaataatatgtcaggacaacgcaatatccccctt
gaactcggcgaacagcccgagcaaccacctttggaggccccaggggcagctgcctccggt
gctgggcctggcgcagccgaagagatggagaccccaccgcctcacagcgagcccgtcccc
gtcgagattgaaggtgaagcctgtggacccccagaagtctccaggcccaagttccagggc
ctcagccaggccatcaaggaagccagagcccatggaggctacagcccacctcctgaagaa
gccatgcccttcgaggtcgagcagtccagcttgggaggcttctggcctaccctggagcac
cctggagacaccactggggcccatgcaggccttgaagccttcagcccaccgatcgtggag
cccagagccttcggtgaggccaggccaagcctgggaagctacagccctcctcccgaagaa
gctatgccctttgagtttgagcagcctgcccagggaggctgcagccaacctctcttgcag
gtctcagacatcgctccaggaggcccaggtgcgggggtctttagggctcctcccgaggag
ccccgagccctcagacctgcaaacgcaggcttcagaggaggatgcagccctccgcctgag
gaggatgtgccatttgagtttgatggagcagcctttggggacgacagcccaccccctggg
ctcccccgagctatcccacaaatcgacggccttggcggcaaccagatcgcggcagtcgcg
gccccgagtgcggtcctcctcgctcccgccgcgaacgagccccccctctgggtcccaggc
atcatcggcagcccatctcgagaggctgtcagacctcctccacacttcgcaggcaacagc
cccccgatggagatctccggacccccgcgcgagattggcagcgcccccgttggggtcgac
gacgctcccgtcaacgtggacagccccccagtcgcgcttgacggcccgcccatcgaggtc
tcccgagccccagttaagagagagcaagcagagggagagagacccccagttgagggagaa
gcagccgagatggaaggaggctcagccgacgctgccgcggagagaggcaaagtccccgat
gccggagacggagcccctgccgccggagcagcccctgacacgccagcccctgccgcccgg
gcagctcctgtcgcccgggccgcccctgtcgcccgggccgcccctgtcgcccgggccacc
cctgtcgcccgggccgctcccgccgcctgggcaaccccagcctctggagcccgacccaag
atcagtttccttagaccccccagccccgagatccaggctgccgatccgcctactccgcag
cctcctcgcgcatatgcctggcggggcaggtctgagcgcagctgctaccgcggcgacgac
gacgacgacgaaatatcggtcagcagcgacagcggagacgaatccgacgatgggaccttc
ggatgccaccgctggtttcagtccaggcgaaaccgccgccgccgaaagacccggcgcaac
ttgctccgcaacttcctcgttcaggccttcagaggctgcttctgccgatccgagagcccc
cagtccagaggctccctcagccccaaggtcaagaaggttgccctggcagagaagggcaga
cagacccgcaaggaaagcatggagaagcgcgtccagaagcgcgcagagaagaaacgcagc
aagctcatcgacaagcagctccaggacgagaagatgggctacatgtgtacgcaccgcctg
ctgcttctagggagaaaagtggtgccgtacaacactgagggtcgtttccagctggacaaa
ccagcgccagcgaccgtaagacgtcgccgagtcgtggggtgggggacggcaagaaaggcg
ggggcttcaggtgctggagaatctggtaaaagcaccatcgtgaagcaaatgaggatcctg
catgttaatgggtttaatggagagggcggcgaagaggacccgcaggccgcaaggagcaac
agcgatggtgagaaggcaaccaaagtgcaggacatcaaaaacaacctgaaagaggccatt
gaaaccatcgtggccgccatgagcaacctggtgccccctgtggagctggccaaccccgag
aaccagttcagagtggactacattctgagcgtgatgaacgtgccagactttgacttccct
cctgaattctacgagcacgccaaggctctgtgggaggacgagggggtgcgtgcctgctac
gagcgctccaacgagtaccagctcatcgactgcgcccagtacttcctggacaagattgac
gtcatcaagcaggctgactatgtgcccagcgaccaggacctgctgcgctgccgcgtccta
acttctggaatctttgagaccaagttccaggtggataaagtcaacttccacatgttcgac
gtgggcggccagcgtgatgaacgccgcaaatggatccagtgcttcaatgatgtgactgcc
atcatcttcgtggttgccagcagcagctacaacatggtcatccgggaggacaaccagacc
aaccgtctgcaggaggcgctgaacctcttcaagagcatctggaacaatagatggctgcgc
accatctctgtgattctgttcctcaacaagcaagatctgctcgctgagaaagtccttgct
ggaaaatcaaagattgaggactactttccagaatttgctcgctacactactcctgaggat
gcgactcccgagcccggagaggacccacgcgtgacccgggccaaatacttcattcgagat
gaatttctgagaatcagcactgctagtggagacgggcgccactattgctaccctcacttc
acctgcgctgtggacacagagaacattcgccgtgtgttcaacgactgccgtgacatcatc
cagcgcatgcacctccgtcagtatgagctgctctaa

DBGET integrated database retrieval system