KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085729
Entry
103085729         CDS       T03090                                 

Definition
(RefSeq) cytochrome P450 4A11-like
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00071  Fatty acid degradation
lve00590  Arachidonic acid metabolism
lve00830  Retinol metabolism
lve01100  Metabolic pathways
lve03320  PPAR signaling pathway
lve04270  Vascular smooth muscle contraction
lve04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103085729
   00590 Arachidonic acid metabolism
    103085729
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103085729
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103085729
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103085729
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103085729
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lve00199]
    103085729
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     103085729
Cytochrome P450 [BR:lve00199]
 Cytochrome P450, animal type
  CYP4 family
   103085729
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 103085729
NCBI-ProteinID: XP_007463994
UniProt: A0A340XXG4
LinkDB
Position
Un
AA seq 510 aa
MSVSVLIPTRALGSVSGLLQVASLLGLVLLLLKAAQLYLHRQWLLKALQQFPSPPSHWLY
GHMQEFQDETELRPLLKRVEKYPSACARWLWGTKALVLIYDTDYMKVVLGRSDPKSHDSY
RLLIPWIGNGLLLLERQTWFQHRRMLTPAFHYDILKPYVGLMADSVQVMLDKWEELVSLD
SHLEVLGHVSLMTLDTVMKCAFSHQGSIQTDRNIQSYIQAIRDLGNLTFSRLRNAFHQND
IIYRLTPEGRWSHRACQLAHQHTDGVIQLRKAHLQKEGELEKVRSKRHLDFLDILLFARM
ENGSSLSDRELRAEVDTFMFEGHDTTASGISWTLYALASHPEHQQRCREEIQSLLGDGTS
ITWDHLDKMPYTTMCIKEALRLYPPVPFISRDLSKPITFPDGRSLPAGIPISLFFYGLHH
NPKVWPKPEVFDPSRFAPGSSQHSHAFLPFSGGSRNCIGKQFAMNEMKVAVALTLLRFEL
APDPSRVPVPIPRVVLKPKNGIHLQLRKLL
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtgctgatccccaccagagccctgggcagtgtctctgggctcctgcag
gtggcctccctgcttggcctggttctgcttctgctcaaggcagcacagctctacctgcac
agacagtggctgctcaaagccctccagcagttcccgtctcctccttcccactggctctat
gggcacatgcaggagttccaagatgagaccgagctgcgacccctactgaagagggtagag
aaatacccaagtgcctgtgctcgctggctgtgggggacgaaagccctggtgttgatctat
gacactgactacatgaaggtggtcctggggagatcagacccaaagtctcatgattcctac
agattgctgattccctggattgggaacggtttgcttttgttggagaggcagacgtggttc
cagcaccggcggatgctgaccccagccttccactatgacatcctgaagccctacgtgggt
ctcatggccgactctgtccaagtgatgctggacaagtgggaggagctcgtcagcctggac
tcacacctggaggtcctcggacacgtctccttgatgaccctggacaccgtcatgaagtgc
gctttcagccaccagggcagcatccagacagacaggaacatccagtcctacatccaggcc
atcagggatctcggcaatttgactttttcccgattaagaaatgctttccaccagaacgac
atcatctacaggctgacccctgaaggccgctggagccaccgggcctgtcagctggcccat
caacacacagatggagtgatccagctgaggaaggctcacctgcagaaggagggagagctg
gagaaggtgaggagcaagaggcacctggatttcctggacatcctcctcttcgccagaatg
gagaatgggagcagcttgtctgacagggagctccgtgccgaagtggatacgttcatgttt
gagggtcacgacaccacagccagcggcatctcctggaccctctatgctctggcctcccac
cctgagcatcagcagaggtgccgggaagagatccagagcctcctgggggatggcacctcc
atcacctgggaccacctggacaagatgccctacaccactatgtgcatcaaggaggcactg
cgactctatccaccagtgccattcattagcagagatctgagcaagcccatcaccttccct
gatggacgctccttacctgcaggaatccccatctccctcttcttttatgggcttcaccac
aacccgaaggtgtggccgaaaccagaggtgtttgacccatcccggtttgcaccaggttct
tctcaacacagccatgctttcctgcccttctcaggaggatccaggaactgcatcgggaag
cagtttgccatgaatgagatgaaggtggccgtggccctgaccctgcttcgctttgagctg
gcgcccgatccctccagggtccctgttcccattccaagagttgtgctgaagcccaagaat
gggatccacttgcagctcaggaagctcctgtaa

DBGET integrated database retrieval system