KEGG   Lipotes vexillifer (Yangtze River dolphin): 103086495
Entry
103086495         CDS       T03090                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve04062  Chemokine signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04217  Necroptosis
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04630  JAK-STAT signaling pathway
lve04659  Th17 cell differentiation
lve04917  Prolactin signaling pathway
lve04920  Adipocytokine signaling pathway
lve04931  Insulin resistance
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05145  Toxoplasmosis
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05162  Measles
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05212  Pancreatic cancer
lve05221  Acute myeloid leukemia
lve05223  Non-small cell lung cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103086495 (STAT3)
   04066 HIF-1 signaling pathway
    103086495 (STAT3)
   04068 FoxO signaling pathway
    103086495 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103086495 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103086495 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103086495 (STAT3)
   04062 Chemokine signaling pathway
    103086495 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103086495 (STAT3)
   04917 Prolactin signaling pathway
    103086495 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    103086495 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103086495 (STAT3)
   05206 MicroRNAs in cancer
    103086495 (STAT3)
   05205 Proteoglycans in cancer
    103086495 (STAT3)
   05203 Viral carcinogenesis
    103086495 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103086495 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103086495 (STAT3)
   05221 Acute myeloid leukemia
    103086495 (STAT3)
   05223 Non-small cell lung cancer
    103086495 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103086495 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103086495 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103086495 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    103086495 (STAT3)
   05161 Hepatitis B
    103086495 (STAT3)
   05160 Hepatitis C
    103086495 (STAT3)
   05163 Human cytomegalovirus infection
    103086495 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103086495 (STAT3)
   05169 Epstein-Barr virus infection
    103086495 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103086495 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103086495 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103086495 (STAT3)
Transcription factors [BR:lve03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103086495 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind SH2 E2R135 DUF4795 Syntaxin-6_N
Other DBs
NCBI-GeneID: 103086495
NCBI-ProteinID: XP_007447254
UniProt: A0A340WJH3
LinkDB
Position
Un
AA seq 654 aa
MYIGSLFWQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN
YKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTL
TDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKG
DPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKF
PELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLRE
QRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWA
SILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGP
GVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERER
AILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIM
GYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPT
TCSNTIDLPMSPRTLDSLMQFGNSGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgtacatcggctcccttttttggcagcaagggggccaggccaaccatcccacagccgcc
gtggtgacggagaagcagcaaatgctggagcaacacctgcaggatgtccggaagcgtgtc
caggacctagaacagaaaatgaaagtggtagagaatctccaggatgactttgatttcaac
tacaaaaccctcaagagtcaaggagatatgcaagacctgaatggcaacaaccagtcagtg
accaggcagaagatgcagcagctcgaacagatgcttactgcgctggaccagatgcggcga
agcatcgtgagtgagttggcagggcttttgtcagctatggagtacgtgcagaaaactctc
acggatgaagagctggcagactggaagaggcggcagcagattgcttgcattggaggccct
cccaacatctgcctagatcggctagaaaactggataacctcattggcagaatctcaactt
cagacccgccaacaaattaagaaactggaggagttgcagcagaaagttagctacaaaggg
gatcccattgtacagcaccggccaatgctggaggagagaatcgtagagctgtttagaaac
ttaatgaaaagtgccttcgtggtagagcggcagccctgcatgcctatgcatcccgaccgg
ccattagtcatcaagactggtgtccagtttacaactaaagtcagattgctggtcaaattt
cctgagctaaattatcagcttaaaattaaagtgtgcattgacaaagactccggggatgtt
gcagctctcagaggatcccggaaatttaacatcctgggcacaaacacgaaagtgatgaac
atggaagagtctaacaacggcagcctctccgcagagttcaaacacttgaccctgagagag
cagagatgtggtaacgggggccgagccaactgcgacgcctccctgattgtgactgaagag
ctgcacctgatcaccttcgagactgaggtgtatcaccaaggcctcaagattgacctagag
acccactccttgccagttgtggtgatctccaacatctgtcagatgcccaatgcctgggca
tccatcctgtggtataacatgctgaccaacaaccccaagaacgtgaactttttcaccaag
cccccaattggaacgtgggatcaagtggccgaggtgctgagctggcagttctcctccacc
accaagcgcgggctgagcattgagcagttgacaacactggcggagaaactcttaggacct
ggtgtgaactattcagggtgtcagatcacatgggctaaattttgcaaagaaaacatggcc
ggcaagggcttctccttctgggtctggctggacaatatcattgaccttgtgaaaaagtac
atcctggccctttggaatgaaggttacataatgggctttatcagtaaggagagggagcgg
gccatcttgagcaccaagcccccaggcaccttcctgctgagattcagtgaaagcagcaaa
gaaggaggagtcaccttcacctgggtggagaaggacatcagcggtaagacccagatccag
tcggtggaaccgtacaccaagcagcagctgaacaacatgtcgtttgctgaaatcatcatg
ggctataagatcatggatgccaccaatatcctcgtgtctccgctggtctacctctaccct
gacattccaaaggaggaggcgttcggaaagtactgtcggccagagagccaggagcatccc
gaagctgacccaggtgctgccccatacctgaagactaagttcatctgtgtgacaccaacg
acctgcagcaataccattgacctgccgatgtccccccgcactttagattcattgatgcag
tttggaaatagtggtgaaggtgctgaaccctcagcaggagggcaatttgaatccctcacg
ttcgacatggagctgacctcggagtgcgccacctcccccatgtga

DBGET integrated database retrieval system