KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087047Help
Entry
103087047         CDS       T03090                                 

Definition
(RefSeq) FAD-dependent oxidoreductase domain-containing protein 1-like
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
SSDB OrthologParalogGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 Pyr_redox HI0933_like Thi4 FAD_oxidored NAD_binding_8 ApbA NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 103087047
NCBI-ProteinID: XP_007467408
UniProt: A0A340Y264
LinkDB All DBs
Position
Un
AA seq 410 aa AA seqDB search
MNKTYDIVIAGAGVIGASCAYQLSKRGNLRIALIDDKRPGNATRASAGGLWAIGESVGLG
CGVIFFRMLSSQAKRQAHGAAVAVDSSTPHILPQCFFDLALQSNALYPQLHQELIERHGM
DFKFERTGLKYVIQDDEDQLYAEHIVKHIPHLQSQIRWLDRQALRKAEPSVTENAHGALE
FLCDHQLSPFRLGDAYMEGARQNGVDLYLNTRVTGVLHQGGRIKGVRTEQAGDFHCDTLI
NAAGAWAAELSEWATGTSIPVKPVKGQIVLTERLPKLLDGCITTSDCYMAQKDNGEILIG
STTEEKGFDVTTTFPEISSLVQGAIRCVPALEQVNLKRTWAGLRPGSPDELPILGPVDEM
PGYFNACGHFRTGVLTSAITGVMLDKVVHEEALPLDITPFLAQRFKISVK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacctatgacatcgtgattgccggtgccggtgtaatcggcgcgtcctgcgcg
taccagctgtccaagcgcggcaacctgcgcattgccctgatcgacgacaagcggcccggc
aatgccacacgtgcttcggcaggcgggctgtgggccatcggcgaatcggtgggcctgggc
tgcggggtgattttctttcgcatgctgtcttcccaggccaagcgccaagctcacggtgcg
gcggtggccgtggactcgagcaccccgcacatcctgccgcaatgtttcttcgatctggcg
ttgcagtccaatgcgctttatccgcaattgcaccaggagctgatcgagcgccacgggatg
gacttcaagttcgagcgcactggactcaagtacgtgatccaggacgatgaggatcagctt
tacgccgagcacatcgtcaagcacatccctcatctgcagtcacagatccgctggctggac
cgccaggcacttcgcaaggcggagccatcggtcaccgaaaacgcgcacggtgcgctggag
tttctctgcgaccaccagctcagcccgtttcgcctgggggacgcctacatggaaggcgca
cggcaaaatggcgtcgacttgtatctcaacacgcgtgtcactggcgtgttgcatcagggc
ggacgcatcaaaggggttcgtaccgaacaggccggtgacttccattgcgacaccctgatc
aatgcggccggcgcctgggctgccgaattgagtgagtgggccacgggcacgtccatcccc
gtcaaacctgtcaaggggcagatcgtgttgaccgagcgcctacccaagctgcttgatggg
tgcatcaccaccagtgactgctacatggcgcaaaaggacaatggggagattctcatcggg
agcaccaccgaggagaaaggcttcgatgtcaccacgactttcccggagatcagcagcctg
gtccagggcgccatacgctgcgtcccggcactcgaacaggtcaacctcaagcgtacctgg
gccggcctgcggccaggctcgcccgatgagctacccatcctcgggcccgtggatgagatg
ccgggttatttcaacgcctgcgggcatttccgcaccggggtgctgacctcggcaatcacg
ggggtaatgctggacaaggtggtccacgaggaggctttgccattggacatcaccccgttt
ctggcgcagcggttcaagatttctgtaaaatga

DBGET integrated database retrieval system