KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087111Help
Entry
103087111         CDS       T03090                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00010  Glycolysis / Gluconeogenesis
lve00053  Ascorbate and aldarate metabolism
lve00071  Fatty acid degradation
lve00260  Glycine, serine and threonine metabolism
lve00280  Valine, leucine and isoleucine degradation
lve00310  Lysine degradation
lve00330  Arginine and proline metabolism
lve00340  Histidine metabolism
lve00380  Tryptophan metabolism
lve00410  beta-Alanine metabolism
lve00561  Glycerolipid metabolism
lve00620  Pyruvate metabolism
lve01100  Metabolic pathways
Module
lve_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
lve_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103087111 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    103087111 (ALDH7A1)
   00620 Pyruvate metabolism
    103087111 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103087111 (ALDH7A1)
   00561 Glycerolipid metabolism
    103087111 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103087111 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    103087111 (ALDH7A1)
   00310 Lysine degradation
    103087111 (ALDH7A1)
   00330 Arginine and proline metabolism
    103087111 (ALDH7A1)
   00340 Histidine metabolism
    103087111 (ALDH7A1)
   00380 Tryptophan metabolism
    103087111 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103087111 (ALDH7A1)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103087111 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     103087111 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     103087111 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103087111
NCBI-ProteinID: XP_007463788
UniProt: A0A340XR29
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MWRVPRLLCVYVARKCKLTGPLNRPAAFMSTLLISQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEDTVKKAREAWRIWADIPAPKRGEVVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERMNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDSDLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSNILYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLDHN
ASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNINIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgttcctcgtctgctctgcgtgtacgttgcaaggaagtgcaagctcacggga
cctttgaacaggcctgccgccttcatgtccactctgctcatcagtcagccccagtatgct
tggctgaaggagctggggctccgcgaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggttatcaccacctattgtcctgctaacaatgagccgatagcgagagtc
cgacaggccagcatggctgactatgaagacactgtaaagaaagcaagagaagcatggaga
atctgggcagatattcctgctccaaagcgaggagaagtagtgagacagattggtgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtctttggagatggggaagatctta
gtggaaggtgtgggagaagttcaagagtacgtggatatttgtgattatgctgttggctta
tctcggatgattgggggacccatcctgccttctgaaagacctggccatgcgctcattgaa
cagtggaatcctgtaggcctggttggaattataactgcgttcaactttcctgtggcggtg
tatggctggaacaacgccattgccatgatctgtgggaatgcctgcctttggaaaggagcg
ccaacaacttctctcattagtgtagctgtcacaaagataatagccaaggttctggaggac
aacaagctgcctggcgcgatttgttccttgacttgtggtggagcggatattggcacagcc
atggccaaagatgagcgaatgaacctgctgtccttcactgggagcactcaggtgggaaaa
caagtggctcttatggtgcaggagaggtttgggagaagtttattagaacttggaggaaac
aatgcaattatagcttttgaggattcggacctcagcttagtcgttccctcagctctcttt
gcagccgtggggacagccggccagaggtgtaccactgcgaggcgcctgtttttacatgaa
agcattcatgatgaagttgttaatagacttaaaaaggcctatgcacagatccgtgttggg
aacccatgggactctaatattctctatgggccactccacaccaaacaggcagtgagcatg
tttcttggagcagtggaggaagcaaagaaagaaggtggcaccgtggtctatggtggcaag
gttatggatcgccctggaaattatgtagaaccgacgattgtgacaggccttgaccacaac
gcgtccattgtacacacagagacttttgccccaattctttatgtctttaaattcaagaat
gaagacgaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaggatttgggcagaatctttcgctggcttggcccaaaaggatcagactgtggcatt
gtaaacatcaacattccaacgagtggggctgagattggaggtgcatttggaggagagaag
cacactggcggtggcagggagtctggtagtgatgcctggaaacagtacatgagaagatct
acttgtaccatcaactacagtaaagacctgcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system