KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087272Help
Entry
103087272         CDS       T03090                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve05164  Influenza A
lve05202  Transcriptional misregulation in cancer
lve05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    103087272 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    103087272 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    103087272 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lve01002]
    103087272 (TMPRSS2)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103087272 (TMPRSS2)
Peptidases [BR:lve01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103087272 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Trypsin_2 SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 103087272
NCBI-ProteinID: XP_007452942
UniProt: A0A340WZ40
LinkDB All DBs
Position
Un
AA seq 537 aa AA seqDB search
MITANVDVAFSSSQASCQALYDVFNSGQLGRSKYLPLLDAADKIRMALNSGSPPGVGPYY
ENHGFQPESLYSPQPPMAHRAYAGYPARYYPPAVPQYTPRVQTHTSTPVILMQPKPPSGP
ACTSRTKKVLCVTLSLGALLAGAVLAAMLLWKLMEDECLGMECSSSGTCVSPSHWCDGIL
HCPSGEDESRCVRLYGPNFILQVYSAQRKSWHPVCQDDWSDNYGRAACQDMGYPNSFFSS
QGIVDDSGATSFMKLNVSANNIDLYKKLYHSDVCSSKTVVSLRCIECGVSGKMSRQSRIV
GGSSAAPGDWPWQVSLHVQGTHVCGGSIITPEWIVTAAHCVEEPLNNPKIWTAFAGILRQ
SFMFYGNGYRVAKVISHPNYDSKTKNNDIALMKLQTPLTFNDRVKPVCLPNPGMMLEPTQ
SCWISGWGSTYEKGKTSDGLNAAMVQLIEPWRCNSKQVYSDLITPAMICAGYLQGTVDSC
QGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYQQMRTCTGL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgataacagcaaatgtggatgtggcgttttcttccagccaggcatcatgccaagctctt
tatgatgtatttaactcaggtcagcttggacgttccaaatacctccctttacttgatgct
gctgataaaatcaggatggctttaaactcagggtcaccaccaggtgtcgggccttactat
gagaaccatggattccaacccgaaagcctctactctccgcagccgcccatggcccaccgt
gcctacgcggggtacccggctcggtactacccgcccgcggtgccccagtacaccccgagg
gttcagacgcacacctcgacacccgtcatcctcatgcagcccaaacccccgtcggggcca
gcatgcacctcaaggactaagaaagtcctgtgtgtcaccctctccctgggggccctcctg
gctggagcagtcctggccgccatgctgctatggaagctcatggaggacgagtgcttgggg
atggaatgcagctcctcggggacctgcgtcagcccctctcactggtgcgacggcatcctg
cactgccccagcggtgaggacgagagccggtgcgttcgactctacggacccaacttcatc
cttcaggtgtactcagctcagaggaaatcctggcaccccgtgtgccaggatgactggagt
gacaactacgggagagcagcgtgccaggacatgggctacccgaatagttttttttctagc
caaggaatagtggatgacagcggggccacaagcttcatgaagctgaatgtcagtgccaac
aatatcgatctctataaaaaactctaccacagtgatgtctgttcctcaaaaacagtggtt
tctttacgctgtatagagtgcggggtctcggggaagatgagccgccagagccggatcgtg
ggcgggtcgagcgctgccccgggggactggccctggcaggtcagcctgcacgtgcagggc
acccacgtctgcggaggctccatcatcacccccgagtggatcgtgaccgccgcccactgc
gtggaggaacctcttaacaatcccaagatttggacggcctttgcaggaattttgagacaa
tctttcatgttctatggaaacggataccgagtagcaaaagtgatttcccacccgaattac
gattccaagaccaagaacaacgacatcgctcttatgaagctgcagacgcctctgactttt
aacgacagagtgaaaccagtgtgtctgcccaacccgggcatgatgctggaaccgacacag
tcctgctggatttccgggtgggggtccacctacgagaaagggaaaacctcggatgggctg
aacgcggcaatggtgcagctcatcgagccctggcggtgcaacagcaagcaggtgtacagc
gacctcatcacgccggccatgatctgcgcggggtacctgcagggaaccgtcgactcctgc
cagggtgacagcggaggtcctctggtcactctgaagagcagcgtctggtggctgatcggg
gacacgagctgggggtctggctgtgctaaggcttaccgaccgggagtgtacggaaacgtg
accgtgtttacagactggatttatcaacaaatgaggacctgcactggcctgtaa

DBGET integrated database retrieval system