KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087287Help
Entry
103087287         CDS       T03090                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04614  Renin-angiotensin system
lve04924  Renin secretion
lve05142  Chagas disease (American trypanosomiasis)
lve05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    103087287
   04614 Renin-angiotensin system
    103087287
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103087287
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    103087287
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lve01002]
    103087287
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103087287
   04090 CD molecules [BR:lve04090]
    103087287
Enzymes [BR:lve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103087287
Peptidases [BR:lve01002]
 Metallo Peptidases
  Family M2
   103087287
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103087287
CD molecules [BR:lve04090]
 Proteins
  103087287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 103087287
NCBI-ProteinID: XP_007456865
UniProt: A0A340XCV7
LinkDB All DBs
Position
Un
AA seq 1302 aa AA seqDB search
MGAASGRRWPRPLLLPLLLLLLLLLLLPPPPPPVVLALNPALQPGNFSADEAGAQGFAES
FNSSAEQVLFHSTAASWAHDTDINEENARRQEEAALLSQEFSEVWGQKAKALFDPIWQNF
TDPTLRRIISAVRTLGPANLPLEERQQYNSLLSNMSRIYSTAKVCFPNKTATCWSLDPEL
TNILAASRSYALLLYAWEGWHNAVGIPLKPLYQKFTALSNAAYKQDGFSDTGAYWRSWYD
SPTFTEDLEHLYHQLEPLYLNLHAYVRRALHRRYGDRFINLRGPIPAHLLGDMWAQSWDK
IYDMVVPFSAKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPS
DGREVVCHASAWDFYNRKDFRIKQCTQVTMDQLSTVHHEMGHVQYYLQYKDQHVSLRQGA
NPGFHEAIGDVLALSVSTPAHLYKIGLLDHVTNDTETDINYLLKMALEKIAFLPFGYLVD
QWRWGVFSGRTPPSLYNYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFV
SFVLQFQFHQALCKEAGHQGPLHQCDIYQSTQAGAKLRALLQAGSSRPWQEVLKDMVGSD
SLDAQPLLTYFQPVTQWLQEQNQQNGEVLGWPEYQWRPPMPDSYPEGIDLVSDEAEASRF
VEEYDRRSQVVWNEYAEASWDYNTNITKEGSEILLEKNVQMANHTVKYGTWARKFDVANF
QNATMKRMIKKIQDLERAALPVRELEQYNQILLDMETTYSVASVCHSNGTCLQLEPDLTN
LMATSRNYGELLWAWKGWRDKVGRSILPYFPQYVELTNKAARLNGYEDGGDSWRSMYEMP
FLEYDLEQLFQELQPLYLNLHAYVRRALYRFYGSELINLEGPIPAHLLGNMWAQSWSNIY
DLVVPFPSAPRMDATEAMIKQGWTPQRMFKEADNFFTSLGLLPVPPEFWSKSMLEKPADG
REVVCHASAWDFFNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANP
GFHEAIGDVLALSVSTPKHLHKINLLSSGDGSYEEDINFLMKMALDKIAFVPFSYLVDQW
RWRVFDGSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYISYRQGD
LGTRLHGPLCLGHSPSQEAGKRLADAMKLGFSRPWPEAMRLITGQPNMSAAALMTYFKPL
LDWLVTENRRHGEKLGWPQYNWMPNSARSEGSFLGSGRVSFLGLNLEEQQARVGQWVLLF
LGVALLVATLGLAHRLFSIRHHSLHQPHRGPQFGSEVELRHS
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccgccggtggccgcggccgctgctgctgccgttgctgctgctg
ctgctgctgctgctgctgctgccgccgccaccgccgcctgtggtcctggctctcaacccc
gcgttgcagccggggaacttttccgccgacgaggccggggcacagggtttcgcagagagc
ttcaattcgagcgccgagcaggtgctgttccacagcacggccgccagctgggcgcacgac
accgacatcaacgaggaaaacgcgcggcgccaggaggaggcagccctgctcagccaggag
ttttcagaggtctggggccagaaggccaaggctctgttcgacccaatctggcagaacttc
accgaccccacgctgcgacgcatcatcagtgccgtgcgcaccctgggccccgccaacctg
cccctggaggagcggcagcagtacaactctctgctaagcaacatgtccaggatttactcc
acggccaaggtctgcttccccaacaagactgccacctgctggtccctggacccagagctc
accaacatcctggctgcgtcgcgaagctacgccctgctactatatgcctgggagggctgg
cacaacgctgtgggcatcccgctgaaacccctgtaccagaagttcactgccctcagcaat
gcggcctacaagcaggatggcttctcagacacgggggcctactggcgctcctggtacgac
tcccccaccttcacggaggatctggagcacctctaccatcagttagagcccctgtacctg
aacctccacgcctacgtccgccgcgcactgcaccgccgatacggggacagattcatcaac
ctcaggggacccatccctgctcacctgctgggggacatgtgggcccagagctgggacaaa
atctacgacatggtggtgcctttctctgccaagcccaatcttgacgttaccagtactatg
gtgcagaagggatggaacgctacacacatgttccgggtggcagaggagttcttcacctcc
ctagggctcttgcccatgcctcctgagttctgggcagagtccatgctggagaagccaagc
gacgggcgtgaggtggtatgccacgcctccgcctgggatttctacaacaggaaagacttc
aggatcaagcagtgcacacaggtcactatggaccagctgtccacggtgcaccacgagatg
ggccacgtgcagtactacctacagtacaaggaccaacacgtctccctgcgccaaggcgcc
aaccccggcttccacgaggccatcggggatgtgctggcgctctccgtctccactcctgca
catctgtacaaaattggcctgctggaccatgtcaccaacgacacggaaaccgacatcaat
tacttgttaaagatggcactggaaaaaattgccttcctgccctttggctacttggtggac
cagtggcgttggggggtctttagtgggcgtacccccccttccctctacaactatgactgg
tggtatcttagaaccaagtatcaggggatctgtcctccagttgtccgaaatgaaacccac
tttgacgctggagccaagtttcatgtcccaaatgtgacaccatacatcaggtactttgtg
agcttcgtcctgcagttccagttccaccaagccctgtgcaaggaggcgggccaccagggc
cccctgcaccagtgtgacatctaccagtccacccaggcaggggccaagctccgggcattg
ctgcaggcaggctcctcgcggccctggcaggaggtgctgaaggacatggtcggctcagat
tccctggatgctcagccgctgctcacctacttccagccggtcacacagtggctacaagag
cagaaccagcagaatggcgaggtgctgggctggccagaatatcagtggcgcccaccgatg
cccgacagttacccagagggcattgacctggtgtccgacgaggctgaggccagcaggttt
gtggaggaatatgaccggagatcccaggtggtgtggaacgagtatgccgaggccagctgg
gattacaataccaacatcaccaaggagggcagcgagatactgctggagaagaacgtacag
atggcaaaccacactgtcaagtacggcacctgggccaggaagtttgacgtggccaacttc
cagaacgccactatgaagcggatgataaagaagattcaggatctagagcgggcggcgctg
cctgtcagggagctggagcagtacaaccagatcctgctggacatggagaccacttacagc
gtggcctctgtgtgccatagcaatggcacttgtctacagctcgagcccgatctgacaaat
ctgatggccacatcccggaactatggagaactgctgtgggcatggaagggctggcgagac
aaggtggggagatccatcctcccatatttcccccaatatgtggagctcaccaacaaggct
gccaggctcaatggctacgaggacggaggggactcctggagatctatgtacgagatgcca
ttcctggagtatgacctggagcagctcttccaggagttgcagccgctctacctgaacctg
cacgcctacgtgcgccgggccctgtatcgcttctacgggtccgagctcatcaacctggag
ggccccatcccagcccacctgctggggaacatgtgggcacagagctggtccaacatctat
gacttggtagtacccttcccttcagcccccaggatggatgccacagaggccatgataaag
cagggctggacaccccaaaggatgtttaaggaagcagacaatttcttcacctccctgggg
ctgctgcccgtgccccccgagttctggagcaagtctatgctggagaagccggccgacggg
cgggaggtggtgtgccacgcctccgcctgggactttttcaatggcaaggacttcaggatc
aagcagtgcaccactgtgaacatggaggacctggtggtggcccaccacgaaatgggccac
atacagtatttcatgcagtacaaggacttgccggtgaccttccgggagggcgccaacccc
ggttttcacgaagccattggggatgtgctggccctctcagtgtctacccccaagcacctg
cacaagatcaacctgctgagtagtggggacggcagctatgaggaggacatcaactttctg
atgaagatggcgctcgacaagatcgcctttgttcccttcagctatcttgtggaccagtgg
cgctggagggtatttgacggaagcatcaccaaggagaactacaaccaggagtggtggagc
ctcaggctgaagtaccagggcctctgtcccccagtggccaggtctcaaggcgactttgac
ccaggggccaagttccacattccttcaagcgtgccatatatcagctaccgtcagggcgac
ctgggcacccggctgcatggcccactgtgtctgggccactcaccttcccaggaggccggg
aagcgcctggccgacgccatgaagctgggcttcagtcggccgtggcccgaagccatgcgg
ctcatcacaggccagcccaacatgtcggccgctgccttgatgacctacttcaagccgctg
ctggactggctcgtgaccgagaacaggcggcacggggagaagctgggctggcctcagtac
aactggatgccaaactcagctcgctcggaaggctccttcctgggctccggccgtgtcagc
ttcctgggcctgaacctggaggagcagcaggcccgcgtgggccagtgggtgctgctcttc
ctgggcgtcgccctgctggtggccaccctgggcctcgcccaccggctcttcagcatccgc
caccacagcctccaccagccccaccgcgggccccagtttggctccgaggtggagctcaga
cactcctga

DBGET integrated database retrieval system