KEGG   Lipotes vexillifer (Yangtze River dolphin): 103088294
Entry
103088294         CDS       T03090                                 

Gene name
CDC42
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04062  Chemokine signaling pathway
lve04144  Endocytosis
lve04360  Axon guidance
lve04370  VEGF signaling pathway
lve04510  Focal adhesion
lve04520  Adherens junction
lve04530  Tight junction
lve04660  T cell receptor signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04670  Leukocyte transendothelial migration
lve04722  Neurotrophin signaling pathway
lve04810  Regulation of actin cytoskeleton
lve04912  GnRH signaling pathway
lve04932  Non-alcoholic fatty liver disease
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve05100  Bacterial invasion of epithelial cells
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05165  Human papillomavirus infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05211  Renal cell carcinoma
lve05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103088294 (CDC42)
   04014 Ras signaling pathway
    103088294 (CDC42)
   04015 Rap1 signaling pathway
    103088294 (CDC42)
   04370 VEGF signaling pathway
    103088294 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103088294 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103088294 (CDC42)
   04520 Adherens junction
    103088294 (CDC42)
   04530 Tight junction
    103088294 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103088294 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103088294 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    103088294 (CDC42)
   04670 Leukocyte transendothelial migration
    103088294 (CDC42)
   04062 Chemokine signaling pathway
    103088294 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103088294 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103088294 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    103088294 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103088294 (CDC42)
   05205 Proteoglycans in cancer
    103088294 (CDC42)
   05203 Viral carcinogenesis
    103088294 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103088294 (CDC42)
   05211 Renal cell carcinoma
    103088294 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103088294 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103088294 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103088294 (CDC42)
   05135 Yersinia infection
    103088294 (CDC42)
   05100 Bacterial invasion of epithelial cells
    103088294 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103088294 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103088294 (CDC42)
   03036 Chromosome and associated proteins [BR:lve03036]
    103088294 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103088294 (CDC42)
   04031 GTP-binding proteins [BR:lve04031]
    103088294 (CDC42)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    103088294 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    103088294 (CDC42)
  Macropinocytosis
   Ras GTPases
    103088294 (CDC42)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103088294 (CDC42)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   103088294 (CDC42)
  Exosomal proteins of breast milk
   103088294 (CDC42)
GTP-binding proteins [BR:lve04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103088294 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 103088294
NCBI-ProteinID: XP_007459269
UniProt: A0A340XJ18
LinkDB
Position
Un
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggtgatggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccttctgagtatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccttatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccagattgatctcaga
gatgacccctctactattgagaaacttgccaagaataaacagaagcctatcaccccagag
actgctgaaaaactggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system