KEGG   Lipotes vexillifer (Yangtze River dolphin): 103088921
Entry
103088921         CDS       T03090                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04630  JAK-STAT signaling pathway
lve04640  Hematopoietic cell lineage
lve04664  Fc epsilon RI signaling pathway
lve05200  Pathways in cancer
lve05202  Transcriptional misregulation in cancer
lve05221  Acute myeloid leukemia
lve05310  Asthma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103088921 (IL3)
   04151 PI3K-Akt signaling pathway
    103088921 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103088921 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103088921 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103088921 (IL3)
   04664 Fc epsilon RI signaling pathway
    103088921 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103088921 (IL3)
   05202 Transcriptional misregulation in cancer
    103088921 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103088921 (IL3)
  09163 Immune disease
   05310 Asthma
    103088921 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lve04052]
    103088921 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:lve00536]
    103088921 (IL3)
Cytokines and growth factors [BR:lve04052]
 Cytokines
  Interleukins
   103088921 (IL3)
Glycosaminoglycan binding proteins [BR:lve00536]
 Heparan sulfate / Haparin
  Cytokines
   103088921 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 103088921
NCBI-ProteinID: XP_007461559
UniProt: A0A340XQC6
LinkDB
Position
Un
AA seq 144 aa
MSSLLILHWLLFLLALYTPQAQGAPVKTPGTQQCYVLNLIREIINELDKLPVASEDFLNS
NEKRRLMKTSLWRPNLEEFLTFATNSLGEDSKITKNLKEIQPILPTTMPTEESILIEKDN
LGDFRVKLKEYLSAIRDSLNCKNT
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagcctcctcatcctgcattggctcctgttcctgctcgcactctacacccctcag
gcacaaggggcaccagtcaagacaccaggaacccaacaatgctatgtactcaacctgatc
cgggaaattataaatgagctagacaagctacctgtggcttcagaagacttcttgaactca
aacgaaaagaggaggctgatgaaaacaagcctctggaggccaaacctggaagaattcctg
acatttgccacaaattcccttggagaggattcgaaaatcacgaaaaatcttaaggaaatc
cagccaatcctgcccacaaccatgcccacggaagagtcaatccttattgagaaggataac
ttgggtgatttccgggtgaaattgaaggaatatctgtctgccattagagactctctgaat
tgtaagaacacatag

DBGET integrated database retrieval system