KEGG   Lipotes vexillifer (Yangtze River dolphin): 103089546Help
Entry
103089546         CDS       T03090                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00052  Galactose metabolism
lve00500  Starch and sucrose metabolism
lve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103089546 (GANC)
   00500 Starch and sucrose metabolism
    103089546 (GANC)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103089546 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103089546
NCBI-ProteinID: XP_007460201
UniProt: A0A340XFE8
LinkDB All DBs
Position
Un
AA seq 914 aa AA seqDB search
MDAAEKEEISVEDEAVDKNIFKDCSKIAFYRRQKQQLSKKSTYRALLDSVTEGKESTRFQ
IINEAAKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPGTVRLISCSGDTGS
LVLANGKGDLKCHITANPFKIDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKENEEDT
SDDTTQENQEELGLWEEKFRNFVDVKDNGPASIGLDFSLHGFEHVYGIPQHAESHQLKNT
SDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEINTEPAV
KYALTQTGPVVAKQKVRSQTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEHDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYLVYAKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTSPKVREWYSSLFAFSVYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSVTGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATKNTKRREPWLFGE
EHTRLIQEAIRERYTLLPYWYSLFYSAHVASQPVMRPLWVEFPDELETFGVEDEYMLGSA
LLVHPVTEPKATVVDVFLPGSSEVWYDSKTFAHWEGACTVKIPVALDTIPVFQRGGSVVP
IKTTIGRSTGCMTDSPYGLWVALSTKGSAVGEFYLDDGHSFQYLHQKQFLHRKFSFASGV
LINSCADKRGHYPSKCVVEQILVLGLKKQPSSVTSHSPDGKAQPVAFTYCAKTSTLTLEK
FSLNIGADWKVQIQ
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcagctctccaagaag
tctacctatcgggcattactagactcagtcacagaaggcaaagagagcaccaggttccaa
atcatcaacgaagcagctaaggttcctctcctggctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaacacccttgaaacccagatatgaagttcctgat
gtcctcacaagcaagccaggcactgtaaggctgatttcatgctcaggggatacaggcagt
ctcgtattggcaaatggaaaaggagatctgaagtgtcacatcacagcaaacccattcaag
atagacttggtatctgaagaagaggttgtgatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagctaccaaggaaaatgaggaggataca
tcagatgacaccactcaggaaaatcaagaggaactgggcctgtgggaggagaaattcaga
aattttgtggatgtcaaagataatggtcctgcctccattggtttggatttctccttgcat
gggtttgagcatgtctatgggatcccgcaacatgcagaatcacaccaacttaaaaatacc
agtgatggagatgcttaccgtctttataacctagatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcaggactcta
ggcattttttggctaaatgcctcagaaacactagtggagatcaatacagaacctgctgta
aagtatgcattgacccagacgggcccagttgttgctaaacaaaaggtcagatctcaaact
gatgtgcactggatgtcagagagtggaatcattgatgtttttttgctgacaggacctaca
ccttctgatgtcttcaagcagtactcataccttacaggcacacaagccatgccccctctc
ttctccttggggtaccatcagtgccgctggaactacgaagatgagcatgatgtaaaggca
gtggatgcaggatttgatgaacatgacattccttacgatgtcatgtggctggacatagag
cacactgaaggcaagaggtacttcacctgggacaagaagaggttcccaaaccccaaaagg
atgcaagagctgctcaggagcaaaaaacgtaagcttgtggtcattagtgacccccacatc
aagattgatcctgactatttagtgtatgctaaggccaaagaacagggcttctttgtgagg
aatcatgaagggggagactttgaaggcgtatgctggcctggtctctcctcttacctggat
tttaccagtcccaaagtcagagagtggtattccagtctttttgctttctctgtttatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctctgtctttagaggg
ccagaactaaccatgcagaagaatgccattcatcatggcaactgggagcaccgagaactt
cacaacatctatggcttttatcagcaaatggccactgcagaaggactgatccagcgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaaatat
ggtgctgtgtggacaggtgacaacacagcagagtggagttacctgaaaatttctatccct
atgttactcaccctcagcgtgactgggatctctttttgtggagcggatgtaggcggcttc
attgggaatccagaggcagagctgctagtgcggtggtaccaggccggagcctaccagccc
ttcttccgtggccatgccaccaagaacaccaagcgacgggaaccctggctctttggggag
gagcacacccggctcatccaagaagccatcagagagcgctacaccctcctgccctactgg
tattctctgttctactctgcacacgtggcttcccaacccgtcatgaggcctctgtgggta
gagttccctgatgaattagagactttcggtgtggaagatgaatacatgctgggaagcgct
ttattggttcacccagtcacagaaccaaaagctactgtggttgatgtgtttctgccagga
tcaagtgaggtctggtatgactctaagacatttgctcattgggaaggagcatgtactgta
aagatcccagtagccttggacacgataccagtgtttcaacgaggtggaagtgtggtacca
ataaagacaactataggaagatccacaggctgcatgactgattccccatatggactctgg
gtggccctaagcactaagggttctgctgtgggtgaattctatctcgatgatggtcattca
ttccaatacctccaccagaagcaattcttgcacaggaagttttcattcgcctcaggtgtt
ttgatcaacagttgtgctgacaagaggggtcattatcccagcaagtgtgtggtggagcag
atcttggtcctaggcctcaagaagcagccatcttctgtgaccagccactcacctgatggt
aaagctcagcctgtggcttttacatattgtgcgaaaacatccaccctgaccctggagaag
ttctcactgaacattggtgctgactggaaggtccaaatccagtga

DBGET integrated database retrieval system