KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090095
Entry
103090095         CDS       T03090                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04390  Hippo signaling pathway
lve04810  Regulation of actin cytoskeleton
lve05200  Pathways in cancer
lve05218  Melanoma
lve05224  Breast cancer
lve05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103090095 (FGF1)
   04014 Ras signaling pathway
    103090095 (FGF1)
   04015 Rap1 signaling pathway
    103090095 (FGF1)
   04390 Hippo signaling pathway
    103090095 (FGF1)
   04151 PI3K-Akt signaling pathway
    103090095 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103090095 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103090095 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103090095 (FGF1)
   05218 Melanoma
    103090095 (FGF1)
   05224 Breast cancer
    103090095 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lve04052]
    103090095 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:lve00536]
    103090095 (FGF1)
Cytokines and growth factors [BR:lve04052]
 Growth factors
  Growth factors (RTK binding)
   103090095 (FGF1)
Glycosaminoglycan binding proteins [BR:lve00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103090095 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103090095
NCBI-ProteinID: XP_007466915
UniProt: A0A340Y5Y7
LinkDB
Position
Un
AA seq 189 aa
MSEVCCSTKDFEALWGKKPIASSLESAITRSCSAMAEGEITTFTALTEKFKLPPGNYKKP
KLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDG
LLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAIL
FLPLPVSSD
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtgaagtttgctgctcaaccaaagacttcgaggctctgtggggaaaaaagcctatt
gccagcagccttgaaagcgccataaccaggagctgctcagccatggctgaaggggaaatc
acaaccttcacagccctgaccgagaagtttaaactgcctccagggaattacaagaagccc
aaactcctctactgtagcaacgggggccatttcctgaggatccttccagatggcacagtg
gatgggacaagggacaggagtgaccagcacattcagctgcagctcagtgcggaaagcgtg
ggggaggtgtatataaagagtacggagactggccagtacttggccatggacaccgacggg
cttttgtatggctcacagacacccaatgaggaatgtttgttcctggaaaggttggaggaa
aaccattacaacacctacacatccaagaagcatgcagaaaagaattggttcgttggtctc
aagaagaacggaagctgcaaacgcggtcctcggactcactacggccagaaagcaatcttg
tttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system