KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090475Help
Entry
103090475         CDS       T03090                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00020  Citrate cycle (TCA cycle)
lve00190  Oxidative phosphorylation
lve01100  Metabolic pathways
lve01200  Carbon metabolism
lve04714  Thermogenesis
lve04932  Non-alcoholic fatty liver disease (NAFLD)
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05016  Huntington disease
Module
lve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lve_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103090475 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103090475 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103090475 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103090475 (SDHA)
   05012 Parkinson disease
    103090475 (SDHA)
   05016 Huntington disease
    103090475 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103090475 (SDHA)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103090475 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 103090475
NCBI-ProteinID: XP_007471980
UniProt: A0A340YKG4
LinkDB All DBs
Position
Un
AA seq 551 aa AA seqDB search
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAF
GGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIRE
GRGCGPEKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVLKHVGGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALGIAE
SCRPGDKVPLIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLR
EGCEKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDFKERVDEYDYSKPIQGQHKRPFEGHWRKHTLSYVDIRTGKVSLEYRPVIDRTLNEAD
CATVPPAIRSY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacaactggaggtggcacttctatgacaccgtgaagggctccgactggctg
ggggaccaggatgccatccactacatgacggagcaggccccggcctcggtggtggagctg
gagaattacggcatgccgtttagcagaactgaagacgggaagatctaccagcgcgccttc
ggtggacagagcctccagtttgggaaaggcgggcaggcccatcggtgctgctgcgtggcc
gaccgcactggccactcgctgctgcacactttgtatggaaggtctctgcgatatgatacc
agctattttgtggagtattttgccttggatctcctgatggagaacggggagtgtcgaggc
gttattgctctgtgcatagaagacgggtccatccaccgcatcagagcaaagaacacggtt
gtagctactgggggctacgggcgcacctacttcagctgcacgtccgcccacaccagcacc
ggggacggcactgccatgatcaccagggcgggccttccctgccaggacctggagtttgtt
cagttccaccccacaggcatatacggtgctggctgtctcatcacggaagggtgccgtgga
gagggaggcatccttatcaacagtcaaggcgagaggttcatggagcgctatgctcctgtc
gcaaaggacctggcgtccagggacgtcgtatcccgctccatgaccctggagatccgtgaa
ggaagaggctgtggccctgagaaggatcacgtgtacctgcagctgcaccacctccccccg
gaacagctggctatgcgcctgcctggcatctcggagacagccatgatcttcgcgggtgtg
gacgtcaccaaggagccgatccccgtgcttcccaccgtgcactataacatgggcggcatc
cccaccaactacaaggggcaggtcctgaagcacgtgggtggccaggaccaggtcgtgccc
ggcctgtacgcgtgtggggaggctgcctgcgcgtcggtgcacggcgccaaccggctaggg
gcgaactcgctcctggacctggtcgtcttcggccgggcgtgcgcgctgggcatcgcggag
tcctgcaggcccggagataaagttcccttgattaaaccaaatgctggggaagaatctgtc
atgaatcttgacaaattgagatttgccaacggaagcataagaacgtcggaactgcggctg
aacatgcaaaagtcgatgcaaagtcatgccgcagtgttccgtgtgggaagcgtgttacgg
gaaggctgtgagaagatcagcaagctctacggcgatctaaagcatctgaagacgtttgac
aggggaatggtctggaacactgacctggtggagaccctggagctgcagaacctgatgctt
tgtgccctgcagaccatttatggagcagaggcccggaaggagtctcgcggcgctcatgcc
agggaggatttcaaggagcgggttgacgagtacgattactccaagcccatccaggggcag
cacaagaggccgtttgaggggcactggaggaagcacacgctctcctacgtggacatcagg
actgggaaggtctccctggaatacagacccgtaatcgacagaacattgaacgaggctgac
tgcgccactgtccccccagccatccgctcctactga

DBGET integrated database retrieval system