KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090503
Entry
103090503         CDS       T03090                                 

Gene name
EGR1
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04371  Apelin signaling pathway
lve04912  GnRH signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve05020  Prion disease
lve05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103090503 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103090503 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    103090503 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    103090503 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103090503 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103090503 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103090503 (EGR1)
Transcription factors [BR:lve03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    103090503 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 zf-BED Zf_RING zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 103090503
NCBI-ProteinID: XP_007461482
UniProt: A0A340XMV2
LinkDB
Position
Un
AA seq 531 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGASGAPEGSGG
NSSSSGGGGGGGGGSNSNSSGGAFNPQGEAGEQPYEHLTAESFPDITLNNEKVLVETSYP
SQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSASSPAASSS
ASQSPPLSCAVQSNDSSPIYSAAPTFPTPNTDIFPEPQGQAFPGSAGTALQYPPPAYPAA
KGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQD
LKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHT
GQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKD
KKADKSVASAATSSLPSYPSPVATSYPSPATTSYPSPVPTSYSSPGSSTYPSPVHSGFPS
PSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTTTFSPRTIEIC
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcggcagccaaggccgagatgcagctgatgtccccgctgcagatctccgaccccttt
ggctcctttcctcattcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaatggggctccccagtttctcggtgcctccggggccccggagggcagcggcggt
aacagcagcagcagcgggggcggtggaggtggagggggcggcagcaacagcaacagcagc
ggcggcgccttcaaccctcagggggaggcaggcgagcagccctacgagcacctgaccgca
gagtcttttcctgacatcactctgaataacgagaaggttctagtggagacgagttacccc
agccaaaccacccggctgccccccatcacctacactggccgcttctctctggagcctgca
cccaacagtggcaacaccttatggcctgagcccctcttcagcctggtcagcggcctcgtt
agcatgaccaaccccccagccacctcatcctcagcatcatctccagcggcctcctcctct
gcctcccagagcccacccctgagctgcgcagtgcagtccaacgacagcagccctatttac
tcagcggcacccaccttccccacacctaacaccgacatcttccctgagccacaaggtcag
gcctttccaggctcagcaggcaccgcgcttcagtacccacctcctgcctaccctgctgcc
aagggtggcttccaggtccccatgatccctgactatctgtttccacaacagcagggggac
ctgggcctgggcaccccagaccagaaacccttccagggcctggagagccgtacccagcag
ccttcgctcactccactctctaccatcaaagcctttgccacacagtcgggctcccaggac
ctgaaggccctcaacaccacctaccagtcccagctcatcaaacccagccgcatgcgcaag
taccccaaccgacccagcaagactcccccccatgaacgcccctacgcctgccccgtggag
tcctgtgaccgccgcttctctcgctcagatgagctcacccgccacatccgcatccacact
ggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagcgaccacctc
accacccacatccgcacccacacaggcgagaagccattcgcctgtgacatctgtgggaga
aagtttgccaggagtgatgaacgcaagaggcataccaaaatccacttgcggcagaaggac
aagaaagcagacaaaagtgtggcctctgccgctacctcctctctcccttcctacccatcc
ccagtggctacctcttacccatccccagccaccacctcatacccatcacccgtgcccacc
tcctactcctctcctggctcctcaacctacccatcgcctgtgcacagtggtttcccatca
ccttccgtggctaccacatactcctccgttcctcctgctttccctgcccaggtcagcagc
ttcccttcctcagctgtcaccaactccttcagcgcctccacagggctttcggacatgaca
accacgttttctcccaggacaattgaaatttgctga

DBGET integrated database retrieval system