KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090612
Entry
103090612         CDS       T03090                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04068  FoxO signaling pathway
lve04110  Cell cycle
lve04115  p53 signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04152  AMPK signaling pathway
lve04218  Cellular senescence
lve04310  Wnt signaling pathway
lve04340  Hedgehog signaling pathway
lve04371  Apelin signaling pathway
lve04390  Hippo signaling pathway
lve04510  Focal adhesion
lve04530  Tight junction
lve04630  JAK-STAT signaling pathway
lve04917  Prolactin signaling pathway
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve05160  Hepatitis C
lve05162  Measles
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05210  Colorectal cancer
lve05212  Pancreatic cancer
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05218  Melanoma
lve05219  Bladder cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05222  Small cell lung cancer
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103090612 (CCND1)
   04340 Hedgehog signaling pathway
    103090612 (CCND1)
   04390 Hippo signaling pathway
    103090612 (CCND1)
   04371 Apelin signaling pathway
    103090612 (CCND1)
   04630 JAK-STAT signaling pathway
    103090612 (CCND1)
   04068 FoxO signaling pathway
    103090612 (CCND1)
   04151 PI3K-Akt signaling pathway
    103090612 (CCND1)
   04152 AMPK signaling pathway
    103090612 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103090612 (CCND1)
   04115 p53 signaling pathway
    103090612 (CCND1)
   04218 Cellular senescence
    103090612 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103090612 (CCND1)
   04530 Tight junction
    103090612 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103090612 (CCND1)
   04921 Oxytocin signaling pathway
    103090612 (CCND1)
   04919 Thyroid hormone signaling pathway
    103090612 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103090612 (CCND1)
   05206 MicroRNAs in cancer
    103090612 (CCND1)
   05205 Proteoglycans in cancer
    103090612 (CCND1)
   05203 Viral carcinogenesis
    103090612 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103090612 (CCND1)
   05212 Pancreatic cancer
    103090612 (CCND1)
   05225 Hepatocellular carcinoma
    103090612 (CCND1)
   05226 Gastric cancer
    103090612 (CCND1)
   05214 Glioma
    103090612 (CCND1)
   05216 Thyroid cancer
    103090612 (CCND1)
   05221 Acute myeloid leukemia
    103090612 (CCND1)
   05220 Chronic myeloid leukemia
    103090612 (CCND1)
   05218 Melanoma
    103090612 (CCND1)
   05219 Bladder cancer
    103090612 (CCND1)
   05215 Prostate cancer
    103090612 (CCND1)
   05213 Endometrial cancer
    103090612 (CCND1)
   05224 Breast cancer
    103090612 (CCND1)
   05222 Small cell lung cancer
    103090612 (CCND1)
   05223 Non-small cell lung cancer
    103090612 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103090612 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103090612 (CCND1)
   04934 Cushing syndrome
    103090612 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103090612 (CCND1)
   05162 Measles
    103090612 (CCND1)
   05160 Hepatitis C
    103090612 (CCND1)
   05163 Human cytomegalovirus infection
    103090612 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103090612 (CCND1)
   05169 Epstein-Barr virus infection
    103090612 (CCND1)
   05165 Human papillomavirus infection
    103090612 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103090612 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103090612
NCBI-ProteinID: XP_007466034
UniProt: A0A340Y332
LinkDB
Position
Un
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELVLVNKLKWNLAATTAHDFIEHFLSKTPVAEESKQLIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSANSFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEGEEEEEADLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgta
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctggtcttggtgaacaaactcaagtggaacctggctgccacgaccgcgcacgacttc
attgaacactttctgtccaaaacaccggtggccgaggagagcaagcagctcatccgcaag
cacgcgcagaccttcgtcgctctctgtgccacggatgtgaagttcatttccaacccgccc
tccatggtggctgccgggagcgtggtggccgcggtgcaaggcctgcacctgggaagcgcc
aacagcttcctgtcctatcaccgcctgacgcggttcctctccaaagtgatcaggtgtgac
ccggactgcctccgcgcctgccaggagcagatcgaggccctcctggagtccagcctgcgc
caggcccagcaacagaacttggaccccaaggccgcggaggagggggaggaggaggaggag
gcggacctggcctgcacgcccaccgacgtgcgtgacgtggacatttga

DBGET integrated database retrieval system