KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090683Help
Entry
103090683         CDS       T03090                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00052  Galactose metabolism
lve00500  Starch and sucrose metabolism
lve01100  Metabolic pathways
lve04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103090683 (GAA)
   00500 Starch and sucrose metabolism
    103090683 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103090683 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103090683 (GAA)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103090683 (GAA)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103090683 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103090683
NCBI-ProteinID: XP_007462408
UniProt: A0A340XLU6
LinkDB All DBs
Position
Un
AA seq 947 aa AA seqDB search
MMRWPPCSCPLLGVCALVSLAILGHLLLHDFDMVPQELHSFSQEEIYPARQPRASSQGPQ
PVPGHHGSPRAAPTQCDLPPDGRFDCAPDKAVTQEQCEARGCCYMPARRPPGTQMGQPWC
FFPPSYPSYRLENLTTTETGYAATLLRATPSFFPKDIMTLRLDVLLETESRLHFSIKDPT
NQRYEVPLETPRVRSQAPSTLYSVEFSEEPFGVIMRRKLDGRVLLNTTVAPLFFADQFLQ
LSTSLPSQHITGLAEHLGPLMLSTNWTKVTLWNRDVAPTPDVNLYGSHPFYLGLEDGGLA
HGVFXXXXXXXXNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDIVGYPFM
PPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFGD
FPAMVQELHQSGRRYIMIVDPAISSSSPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPG
LTAFPDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPNSNLENPPY
VPGVVGGTLRAATICASSHQFLSTHYDLHNLYGLTEAFASHRALVKARGTRPFVISRSTF
AGHGQYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQ
LGAFYPFMRNHNGLNSLPQEPYRFSETAQRAMRKAFALRYMLLPYLYTLFHGAHVRGETV
ARPLFLEFPEDPHTWTVDRQLLWGEALLITPVLKAGKVEVTGYFPRSTWYDLQTVPVEAF
GSLPPPAPLTSAIHSEGQWVTLSAPLDTINLHLRAGHIIPMQGPGLTTTESRKKPMALAV
ALTASGEARGELFWDDGESLGVLDRGAYTQVIFLARNNTIVNQLVHVSSEGAGLQLRKVT
VLGVATAPQQVVCNGVSVSNFTYGPDTETLDIPVSLTLGEQFLISWS
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccctgttcctgccccctgctgggggtctgcgccctagtctccttg
gccatcctggggcacctcctgcttcatgacttcgacatggtcccccaagagctgcacagt
ttctcccaagaggagatttacccggctcgccagcccagagccagcagccaagggccccag
cccgtcccagggcaccacggcagccccagggcagcacccacacagtgcgacctgccccct
gacggccgcttcgactgcgcccccgacaaggccgtcacccaggagcagtgtgaggcccgg
ggctgctgctacatgcctgcaaggcggcctccgggcacccagatggggcagccctggtgc
ttcttccctcccagctaccccagttacaggctggagaacctgaccaccaccgagacgggc
tacgcggccaccctgctccgtgccacgccgagcttcttccccaaggacatcatgaccttg
cggctggacgtgctgctggagactgagagccgcctccacttctcgatcaaagatcccacc
aaccagcgctatgaggtgcccttggagaccccacgtgtccgcagccaggcgccgtccacg
ctctacagcgtggaattctcagaggagcccttcggggtgatcatgcggcggaagctggat
ggacgggtgctgctgaacaccaccgtggcccccctgttcttcgccgaccagtttctgcag
ctgtccacctccctgccgtcccagcacatcacgggcctcgccgaacacctcgggcccctg
atgctcagcaccaactggaccaaggtcactctctggaacagggacgtcgcccctacgccc
gacgtgaacctatatggatctcaccctttctacctgggcctggaggatggcggtttagct
cacggggtcttcnnnnnnnnnnnnnnnnnnnnnnncaatgccatggatgtggtcctgcag
cccagcccggccctcagctggaggtcgacaggcgggatcctggatgtgtacatcttcctg
ggcccggagcccaagagcgtggtgcggcagtacctggacatcgtgggctacccgttcatg
ccaccatactggggcctgggcttccacctgtgccgctggggctactcctccaccgccatc
acccgccaggttgtggagaacatgaccagggcacacttccctttggacgtccagtggaat
gacctggactacatggacgccaggcgggacttcactttcaacaaggacggctttggggac
ttcccggccatggtgcaggagctccaccaaagtggccggcggtacatcatgattgttgat
cctgccatcagcagctccagccctgccgggacctaccgaccctacgacgagggtctgagg
cggggggtcttcatcaccaatgagactgggcagccgctgattggacaggtatggcccgga
ctcaccgccttccctgacttcaccaaccccgaggcccttgactggtggcaggacatggtg
gccgagttccacgcccaggtgccctttgacggcatgtggatcgacatgaacgagccatcc
aattttgtgaggggctcagtggatggctgccccaacagcaacctggagaacccgccctac
gtgccaggggtggttggcgggaccctccgggcagccaccatctgcgcctccagccaccag
ttcctgtccacgcactacgacctgcacaacctgtacggcctgaccgaagccttcgcctcc
cacagggctctggtaaaggctcgggggacgcgcccctttgtgatctctcgctccaccttt
gccggccacggccagtacgccggccactggacaggggatgtgtggagcagctgggagcag
ctttcctactccgtaccagaaatcctgctcttcaatctgctgggggtgcccctggtgggg
gccgacatctgtggcttcctgggcaacacttcggaggagctgtgtgtgcgctggacccag
ctgggggccttctaccccttcatgcggaaccacaatggcctgaatagcctgccacaggag
ccgtacaggttcagcgagacggcacagcgagccatgaggaaggcctttgccctgcgctac
atgctgctgccctatctctacacgctgttccatggggcccacgtcagaggcgagaccgtg
gcccggcccctcttcttggagttccccgaggatccccacacctggacagtggaccgccag
ctcctgtggggggaggctctgctcatcaccccggtgctcaaggccgggaaggttgaggtc
actggctacttcccccgcagcacgtggtacgacctgcagacggtgccagtggaggccttt
ggcagcctcccacctcctgcacccctcacgtctgccatccacagcgaggggcagtgggtg
acactgtccgccccactggacaccatcaacctccacctccgggccgggcacatcatcccc
atgcagggccctggcctcacgaccacagagtcccgcaagaagcccatggccctggctgtg
gccctgactgcgagcggggaggcccgaggggagctgttctgggacgatggggagagccta
ggagtgctggaccgtggggcgtacacgcaggtcatcttcctggccaggaacaacaccatc
gtgaaccagctagtgcacgtgagcagtgagggggctggcctgcagctgaggaaggtgacc
gtcctgggggtggccacagccccccagcaggtcgtctgcaatggcgtttctgtatccaac
ttcacctacggccctgacacggagaccctggacatccctgtctcgctgacactgggagag
cagttcctcatcagttggtcttaa

DBGET integrated database retrieval system