KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090973Help
Entry
103090973         CDS       T03090                                 

Gene name
KMT5C, SUV420H2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103090973 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lve03036]
    103090973 (KMT5C)
Enzymes [BR:lve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103090973 (KMT5C)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103090973 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103090973
NCBI-ProteinID: XP_007468108
UniProt: A0A340Y4C8
LinkDB All DBs
Position
Un
AA seq 455 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRLQPKEPLPPRPLDKYELRETKRRLQQGLDGPRACAHPPPLRRDLFCAACQPLRPPPC
GARPDASPLWLQWLPQPRLRVRPRRRRRPQPRRAPAPPVLRAARVSLHRWGGCGPHCCLQ
AEALVALGPASRARWAPQQDWHWARRYGLPYVVRVDLSRVAPAPPATATPVPTGTPGPIP
IPKQALAFAPFSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggccccgacagagtgacagccagggaactgtgtgaaaatgacgacctcgccaccagc
ctcgtcctggacccctacctcggcttccgcacccacaagatgaacgtcagccccgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccgagccttc
ctgcctgaaagcggcttcaccatcttgccctgtacccgttattccatggagacaaatgga
gccaagattgtgtctacccgtgcttggaaaaagaacgagaagttggagctgctggtgggc
tgcatcgcagagctgcgggaggccgacgaggggctgctgagggccggggagaacgacttc
agtatcatgtactccacccgcaagcgcagcgctcagctgtggctcggcccggccgccttc
atcaaccacgactgcaaacccaactgcaagttcgtacctgcagatgggaacgcagcctgc
gtgaaggtgctccgggacatcgagccaggggacgaggtgacctgcttctacggcgaaggc
ttcttcggtgaaaagaatgagcactgtgaatgctacacctgcgagaggagaggcgaagga
gctttccgactgcagcccaaggagcccctgccaccccggcccctggacaagtatgagctc
cgggagacaaagcggcggctgcagcagggcctagatggcccccgggcctgtgcccaccca
cccccgctgcgccgggacctgttctgcgctgcctgccagcccctgcgccccccgccctgc
ggcgcccgccccgatgcctcacccctctggctccagtggctgcctcagccccggctccgg
gtgcgcccccggaggcgccgacgcccccagccccggcgggccccggcgccccccgttctc
cgtgctgcccgcgtctccctgcaccgatggggaggctgtggcccccactgctgcctgcag
gcggaggccctggtggctctggggccggcctcccgtgcccgctgggccccccagcaggac
tggcactgggcccggcgctacgggctgccttacgtggtacgtgtggatctgagccgtgtg
gccccggccccgcctgccactgccactcccgtccccactgggacccccggccccatcccc
atccccaagcaggcccttgcctttgcccccttctccccacccaagcgcctgcggctggtg
gtcagccatggctccattgacctggatgtcaacggtgatgggccgtga

DBGET integrated database retrieval system