KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091082Help
Entry
103091082         CDS       T03090                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103091082 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lve03036]
    103091082 (KMT5B)
Enzymes [BR:lve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103091082 (KMT5B)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103091082 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103091082
NCBI-ProteinID: XP_007450470
UniProt: A0A340WUA6
LinkDB All DBs
Position
Un
AA seq 882 aa AA seqDB search
MKWLGESKNMVLNGRRNGGKLSNDHHQNQSKLQHTGKDTVKAGKNAAERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLSKSKAQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGMKKNSKSRALTRQSMSGIPA
SSNSTSSKLTPINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKSASGKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPVPAAAASGCLTRHAAREHRQNSGRGAPAHADGAPCAYTTRR
SLRTRMNLKETSDIKLEPNTLDGYKSSSTEPCPDSGEQPSPAVQEELAHEAAQKGEAKCP
KSDSSTSKKKSRQGKLVRQLAEAEESAAVHGSPGRAGVGREGVGSHPDRGERGSLEGVPG
SYTDWPPSPVSGSVVASDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRR
HDSSSKTNDQENDGVNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKR
DEESRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTADSSSSEGGGEEEDYDD
DFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtgttgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcatcagaatcaatcaaaattacagcacacgggaaaggacaccgtg
aaggctggcaagaacgcagccgagaggaggtcaagcagatgtaatggtaattcaggattc
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactctgtgaaaat
gatgacttagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagtttttct
cacaacaaccctgtgagatttcggcctattaaaggaagacaagaagaactaaaggaagta
attgaacgtttcaagaaagatgagcacttggagaaagccttcaagtgtctgacttcaggg
gagtgggctcggcactatttcctcagcaagagcaaagcgcaggagaagttattcaaggaa
catgtatttatttacttgcgaatgtttgcaaccgacagtggatttgaaatattgccttgt
aatagatattcatcggaacaaaatggagccaaaattgttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgctgcgtttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggctctaagagacattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggt
atgaaaaagaacagcaagagcagagcattgacaaggcagtccatgtcaggaattccagct
tcttccaactctacctcatctaagctaactcctataaataattccagggtaccaaagaaa
ctgaaaaaacctgcaaagcctttactttcaaagataaaactaagaaatcattgcaaacgg
ctggagcagaagagtgcttcgggaaaactggagatgggaaacttagtacttaaagaacct
aaagtagttctgtacaaaaatttgccgattaagaaagataaggagccggagggaccagtc
ccagccgcggcggccagtgggtgcttaactagacacgcggcgcgagagcacaggcagaac
tccgggcgaggcgcccctgcgcacgcggacggcgccccctgcgcctacacaacccggcgg
tccttgaggacgaggatgaatttgaaggagacctccgacatcaagctcgaaccaaatacg
ttggatggctacaaaagcagctcgacggaaccttgcccggacagtggcgagcaaccatct
cctgcggtgcaggaagaactggctcatgaagctgcccagaagggggaggccaagtgtcct
aagagcgacagcagcacgtcgaaaaagaaatcacggcaagggaaactggtgagacagttg
gcagaagcagaggaatccgctgcggtgcacggctcccccggcagagccggcgtggggcga
gagggcgtggggtcgcaccctgaccggggcgagcgcggcagcctggagggcgtgcccggg
agctacacggactggcccccttctcctgttagcggttctgtggtcgcatcagacagcttc
aaaacaaaagacagcttccgaactgcaaaaagtaaaaagaagaggcggatcactaggtat
gatgcacagttaatcctagagaataactctgggattcccaaattgactcttcgtaggcgt
catgacagcagcagcaagacaaatgaccaagagaacgatggagtgaattcttcaaaaata
agcatcaagttaagtaaagaccatgaaaatgataataatctctatgtagcaaagcttaat
aatggatttaactcaggatcaggcagtagctctacaaagttaaaaatccagctaaaacgg
gacgaggagagtagggggtcgtatacagaggggcttcacgaaaatggggtgtgctgcagt
gatcctctttctctcctggagtctcgcatggaggtcgatgactatagtcagtacgaggag
gaaagtaccgctgattcctcctcttcggagggaggcggggaggaggaggactatgatgac
gactttgaggacgacttcatcccgcttcctccggcgaagcggctgaggctcatagtcgga
aaagactctatagatattgacatttcttccaggagaagagaagatcagtctttgaggctt
aacgcatag

DBGET integrated database retrieval system