KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091203
Entry
103091203         CDS       T03090                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04620  Toll-like receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04912  GnRH signaling pathway
lve04926  Relaxin signaling pathway
lve04935  Growth hormone synthesis, secretion and action
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05142  Chagas disease
lve05161  Hepatitis B
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103091203 (MAP2K4)
   04012 ErbB signaling pathway
    103091203 (MAP2K4)
   04668 TNF signaling pathway
    103091203 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103091203 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    103091203 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103091203 (MAP2K4)
   04926 Relaxin signaling pathway
    103091203 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    103091203 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103091203 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103091203 (MAP2K4)
   05135 Yersinia infection
    103091203 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103091203 (MAP2K4)
   05161 Hepatitis B
    103091203 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103091203 (MAP2K4)
   05169 Epstein-Barr virus infection
    103091203 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103091203 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103091203 (MAP2K4)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103091203 (MAP2K4)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE7 family
   103091203 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103091203
NCBI-ProteinID: XP_007455070
UniProt: A0A340X7M8
LinkDB
Position
Un
AA seq 410 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPAGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggccccgtggggtccccggcgcccggccacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctgcaggagttcaa
aacccacacatagagagactgagaacacacagcattgaatcgtcaggaaaactgaagatc
tcccctgagcagcactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggcgcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggcg
gttaaaagaattcgctcaacagtggatgaaaaagagcaaaaacaacttctcatggatttg
gatgtagtgatgcgaagtagtgattgcccgtacattgttcagttttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaagcactcaaccacttaaaagaaaacttgaaaatcattcacagagat
atcaaaccttccaatattcttctggatagaagtggaaatattaaactctgcgactttggc
atcagtggacagcttgtggactccattgccaagacaagagatgctggttgcaggccatac
atggcacctgaaagaatagacccaagtgcgtcacgacaaggatatgacgtccgctctgat
gtctggagtttggggatcacattgtacgaattggccacaggccgatttccttatccaaag
tggaatagtgtgtttgatcaactaacacaagttgtgaaaggagacccaccacagttgagt
aattctgaggaaagggaattttccccaagtttcatcaactttgtcaacttgtgccttacc
aaggatgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttgatg
tatgaagagcgcgctgtcgaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgactga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091499
Entry
103091499         CDS       T03090                                 

Gene name
MAP2K7
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04141  Protein processing in endoplasmic reticulum
lve04380  Osteoclast differentiation
lve04530  Tight junction
lve04620  Toll-like receptor signaling pathway
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04722  Neurotrophin signaling pathway
lve04912  GnRH signaling pathway
lve04926  Relaxin signaling pathway
lve05010  Alzheimer disease
lve05016  Huntington disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05161  Hepatitis B
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103091499 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103091499 (MAP2K7)
   04012 ErbB signaling pathway
    103091499 (MAP2K7)
   04668 TNF signaling pathway
    103091499 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103091499 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103091499 (MAP2K7)
   04660 T cell receptor signaling pathway
    103091499 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    103091499 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103091499 (MAP2K7)
   04926 Relaxin signaling pathway
    103091499 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103091499 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103091499 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103091499 (MAP2K7)
   05016 Huntington disease
    103091499 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    103091499 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103091499 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103091499 (MAP2K7)
   05135 Yersinia infection
    103091499 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103091499 (MAP2K7)
   05161 Hepatitis B
    103091499 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103091499 (MAP2K7)
   05169 Epstein-Barr virus infection
    103091499 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103091499 (MAP2K7)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103091499 (MAP2K7)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE7 family
   103091499 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103091499
NCBI-ProteinID: XP_007460673
UniProt: A0A340XGX0
LinkDB
Position
Un
AA seq 435 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP
RASGVLSQHHLPFFR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcgaagctgaagcaggag
aaccgcgaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctgcag
ctcccactggccaatgatgggggcagccgctcaccgtcctccgagagctccccgcagcac
cccacgccccccgcacggccccgccacatgctggggctcccgtcaaccttgttcacaccc
cgcagcatggagagcatcgagattgaccagaagctgcaggagatcatgaagcagacgggc
tacctgaccattgggggccagcgctaccaggcggaaatcaacgacctggagaacctgggg
gagatgggcagcggcacctgtggccaggtgtggaagatgcgtttccggaagacggggcac
gtcatcgctgtcaagcaaatgcggcgctcggggaacaaggaagagaacaagcggatcctc
atggacctggacgtggtgctcaagagccacgattgcccctacatcgtgcagtgcttcggg
accttcatcaccaacacggacgtcttcattgccatggagctcatgggcacgtgcgccgag
aagctcaagaagcggatgcagggccctattcctgagcggatcctgggcaagatgacggtg
gcgatcgtgaaggcactctactacctgaaggagaagcacggcgtgatccaccgggacgtc
aagccctccaacatcctgctggatgagcggggccagatcaagctctgcgacttcggcatc
agtggccgcctcgttgactccaaagccaaaacgcggagcgcaggttgcgctgcctacatg
gcacctgagcgcatcgaccccccagaccccaccaagcccgactacgacatccgggccgat
gtgtggagcctgggcatctccttggtggagctggcgacgggacagtttccctacaagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagaacccccgctcctgccc
ggtcacatgggcttctcgggggactttcagtccttcgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcgctacgag
acgctggaggtggacgtggcgtcctggttcaaggacgtcatggcgaagaccgagtcgccg
cgggcgagcggggtcctgagccagcaccacctgcccttcttcaggtag

DBGET integrated database retrieval system