KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091353Help
Entry
103091353         CDS       T03090                                 

Gene name
SLC16A2
Definition
(RefSeq) solute carrier family 16 member 2
  KO
K08231  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103091353 (SLC16A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lve02000]
    103091353 (SLC16A2)
Transporters [BR:lve02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   103091353 (SLC16A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    103091353 (SLC16A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Transgly_assoc
Motif
Other DBs
NCBI-GeneID: 103091353
NCBI-ProteinID: XP_007450402
UniProt: A0A340WRZ0
LinkDB All DBs
Position
Un
AA seq 404 aa AA seqDB search
VFVLLFSAAWVGALSMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLS
LRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSISFPLLIKTLGA
KIKLAQTFQVLSTFMFILTLLSLTYRPLLPSSQDTPSKRGVHTLCQRFLAQLRKYFNMRV
FRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFMEIKQTWVLLVCIGATSGLGRLVSG
RVSDSIPGLKKIYLQVISFLLLGLMSMMIPLCRGFGGLIVVCLFLGLCDGFFITIMAPIA
FELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIVGAVILL
FVPLMHQRMFKKEQRDSSKDKMLTPDPDPNGELLPGSPTPEEPI
NT seq 1217 nt NT seq  +upstreamnt  +downstreamnt
gtgtctttgtgcttcttttctctgcagcatgggtaggagccctctcaatgggcatgattt
tcttctgttctcccattgtgagtatattcactgatcgattgggctgccgaatcacagcaa
ctgcaggggctgccgtcgctttcattggcctccataccagctccttcaccagctcactaa
gcctgcgttacttcacctacgggattctctttggttgtggctgttccttcgcctttcagc
catctctcgtcatcctgggccattacttccaacgccgtctgggtctggccaatggtgtgg
tgtctgctgggagtagcatcttctccatatccttccccctcctcatcaaaacgctggggg
ctaagatcaagctcgcccaaaccttccaggtgctgagtacctttatgtttattcttacac
tgctttcactcacctaccgacccctcctgcccagctcgcaggacaccccaagcaagagag
gtgtccataccctgtgccaacgctttctggctcagctcaggaagtacttcaacatgcgag
tgttccgccaacgtacctaccgcatctgggccttcgggatcgctgctgctgcccttggct
acttcgttccctatgtacacttgatgaagtatgtggaagaggaattcatggaaatcaagc
agacctgggtgctcttggtgtgtattggagctacctcaggccttgggcgccttgtgtcag
gccgtgtcagtgactccattcctggacttaagaagatctacttgcaggtcatctccttcc
tgctcctgggcctgatgtccatgatgattcccctctgccggggcttcgggggcctcatcg
ttgtctgtctcttcctgggcctgtgtgatggcttcttcatcaccatcatggcccccatcg
catttgagctggtgggcccaatgcaggcctcacaggccattggctacctcctgggcatga
tggccctgccgatgattgccggaccccccattgcagggctcctccgcaactgttttgggg
actatcatgtggccttctactttgccggtgtgcccccgatcgtcggagctgtaatcctct
tgtttgtccctctgatgcatcaaaggatgttcaagaaagagcaaagggattccagcaagg
ataagatgttgacccctgacccagaccccaatggagagctgctgccaggctcccccacac
ctgaggaaccaatctaa

DBGET integrated database retrieval system