KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091524
Entry
103091524         CDS       T03090                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103091524 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103091524 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lve03310]
    103091524 (NR3C1)
Transcription factors [BR:lve03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103091524 (NR3C1)
Nuclear receptors [BR:lve03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103091524 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103091524
NCBI-ProteinID: XP_007466922
UniProt: A0A340Y3E1
LinkDB
Position
Un
AA seq 780 aa
MDPKESLSPPSREEIPSSVLGRERGSVMDFYKTLRGGATVKVSASSPSLAAASQADSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQMSLSSGETDF
RLLEESIANLNRSTSVPENPKNSASAAASAAPTEKEFPKTHSDVSEQQNLKGQTGTNGGN
VKLYTTDQSTFDIWRKKLQDLEFSSGSPGKETSESPWSSDLLIDENCLLSPLAGEDDPFL
LEGNSKEDCKPLLLPDTKPKIKDNGDLILSSPNSVPLPQVKTEKEDFIELCTPGVIKQEK
LGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPP
VPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPP
PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
YRKCLQAGMNLEARKTKKKIKGIQQATTGVSQESSENSANKTIVPATLPQLTPTLVSLLE
VIEPEVIYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQ
YSWMFLMSFALGWRSYRQSSSNLLCFAPDLIINEQRMALPCMYDQCKHMLYVSSELNRLQ
VSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQ
LTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQK
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcattaagcccccccagtagagaagaaatccccagcagtgtgctt
ggtcgagagaggggaagtgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttcaccctcactggctgctgcttctcaggcagactccaagcagcaa
agacttttggttgattttccaaaaggctccggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactctcaatgggactgtatatgggagagacagagacaaaagtaatggga
aatgacctgggattcccacagcagggccaaatgagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagaattcagcatcagctgctgcctctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtatcagaacagcaaaatttgaagggccagactggcactaatgggggtaat
gtgaagttgtataccacagaccaaagcacctttgacatatggaggaaaaaactccaggat
ttggagttttcttctgggtccccaggtaaagagacaagtgagagcccttggagctcagac
ctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattcctt
ctggaaggaaactcaaaagaggactgtaagcctcttcttttaccggacactaaacctaaa
attaaggataatggagatctgatcttatcaagccctaacagtgtgccactgccccaagtg
aaaacagaaaaggaagattttatcgaactctgcacccctggagtaattaagcaggagaaa
ctgggcccagtttattgtcaggccagcttttctggagcaaatataattggtaataaaatg
tctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgacatg
aatacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattccacca
gttcctgttggttcagaaaattggaatagatgccaaggatctggagatgataacttgact
tccttagggactttgaacttctccggtcgatcggttttttctaatggctattcaagccct
ggaatgagaccagatgtgagctctcctccatccagctcctcagcagcaacgggaccacct
cccaagctctgcctagtgtgctctgatgaagcttcgggatgtcattatggggtcttaact
tgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattatctttgt
gctggaagaaatgactgcatcattgataaaattcgaagaaaaaactgcccagcatgccgc
tatagaaaatgtcttcaagcaggaatgaacctggaagctcgaaaaacaaagaaaaagata
aaaggaattcagcaggccactacaggagtctcacaagaaagttctgaaaattctgctaac
aaaacaatagtccctgcaacgttaccgcaactcacccctaccctggtgtcactgctggag
gtcattgagccggaggtgatatatgcgggctacgacagctccattccagatacaacttgg
cggatcatgactacactcaacatgttaggtgggcggcaggtgatcgcagcggtgaaatgg
gcgaaggcgataccaggattcaggaacctacatctggatgaccaaatgaccctactgcaa
tattcatggatgtttctcatgtcattcgccctggggtggagatcatatagacaatcaagt
tcaaacttgctgtgttttgctcctgacctgattattaatgagcagagaatggctttaccc
tgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaaacagacttcag
gtatcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaag
gaaggtttgaagagtcaagagctgtttgatgaaattagaatgacctacatcaaagagcta
ggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttttaccaa
ctgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaactattgcttc
cagacatttttggataagaccatgagtattgaattcccagagatgttagctgaaatcatc
accaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaag
tga

DBGET integrated database retrieval system