KEGG   Lacinutrix venerupis: BWR22_12000Help
Entry
BWR22_12000       CDS       T04680                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lvn  Lacinutrix venerupis
Pathway
lvn00010  Glycolysis / Gluconeogenesis
lvn00020  Citrate cycle (TCA cycle)
lvn00620  Pyruvate metabolism
lvn01100  Metabolic pathways
lvn01110  Biosynthesis of secondary metabolites
lvn01120  Microbial metabolism in diverse environments
lvn01130  Biosynthesis of antibiotics
lvn01200  Carbon metabolism
Module
lvn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWR22_12000
   00020 Citrate cycle (TCA cycle)
    BWR22_12000
   00620 Pyruvate metabolism
    BWR22_12000
Enzymes [BR:lvn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BWR22_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C RnfC_N RP-C_C
Motif
Other DBs
NCBI-ProteinID: APY01000
UniProt: A0A1P8RQS9
LinkDB All DBs
Position
complement(2645545..2647182)
Genome map
AA seq 545 aa AA seqDB search
MAEVINMPRLSDTMEEGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFNEGTLLHIG
IQEGETAKVDSLLAIIGEEGEDISGLLEGGSAEEKPTENKSKEEDKVEEESDNSTATEST
SESLPEGVVVVTMPRLSDTMEEGTVATWLKKVGDTVEEGDILAEIETDKATMEFESFQSG
TLLHIGLEEGDSAKVDSLLAIIGPEGTDVSSVAKNFSVEGASAKKEEAPKKETPKKEAPK
TEAKKEAPKASASTSNSTPDGGRVFVSPLAKKMAEEKGIQLNHVKGTGENGRIVKRDIEN
FTSTQASSASAAKFVPTGQEDFDEVPNSNMRKAIAKNLAKSKFTAPHYYLNVEFDMENAI
AFRKQYNSVPDTKISYNDIVVKACALALKQHPQVNSQWFDDRMKLNNHVHIGVAVAVPDG
LLVPVVKFANEQTLPQIGAAVREYAGKARNKKLALDEMEGSTFTVSNLGMFGIDSFTSII
NQPNSAILSVGNIVEKPVVKNGQIVVGNTMKLCLACDHRTVDGATGAQFLQTLKGYIENP
VTMLV
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaataaatatgccgcgtttaagcgacacaatggaagaaggaactgtagca
agttggcttaaaaaagtaggtgataaagtagaggaaggcgatatattagctgaaattgaa
acagacaaagctaccatggaatttgaatcttttaatgaaggtacattacttcatattggt
attcaagaaggagagacagcaaaagtagattcacttttagctattattggagaagaaggt
gaagatatttcaggtttattagaaggcggttctgcagaagaaaaaccaacagaaaataaa
tctaaagaagaagataaagttgaagaagagtctgataactcaacagcaaccgaatcaaca
tctgaaagtttaccagaaggagttgttgttgtaacaatgccacgtttaagtgatactatg
gaggaaggtactgtagcaacttggttaaagaaagttggtgatacagtagaggaaggcgat
attcttgcagaaatagagacagataaagcaacaatggagtttgaatcttttcagtctgga
actttacttcatataggtttagaagaaggagattctgctaaagtagattcgcttttagca
attattggccctgaaggaacagatgtgtcttctgtagcaaaaaacttttcagtagaaggt
gcttcagctaaaaaagaagaagcaccaaaaaaggaaacgcctaaaaaggaagctccaaaa
acagaagctaaaaaagaagcacctaaagcttcagcttcgacatcaaattctacaccagat
ggtggtagagtatttgtttcacctttagctaaaaaaatggcagaggagaaaggtattcag
cttaatcacgttaaaggaacaggagaaaatggtcgtattgtaaagcgagatatagaaaac
tttacttctactcaagcatcatcggcatcagcagctaaatttgtacctactggtcaagaa
gattttgatgaagttccaaactctaacatgcgtaaagctattgctaaaaacttagcaaaa
tctaaatttactgcaccacattactatttaaatgtagagtttgatatggaaaatgctatt
gcttttagaaagcaatacaattctgtaccagatacaaaaatatcttataatgatattgtt
gtaaaagcatgtgcattagctttaaaacaacatccacaggttaactctcagtggtttgac
gatagaatgaaattaaataaccatgtacatattggtgttgcagtagcagtaccagacggt
ttattagtaccagtagttaaatttgctaacgagcaaactttaccacaaattggtgcagcg
gttagagaatatgctggtaaggcaagaaataaaaaacttgctttagacgaaatggaaggt
agtacttttactgtttctaatttaggaatgtttggtatagatagttttacttctattatt
aatcaacctaattcagcaattttatctgttggaaatattgtagagaagccagtagttaaa
aacggacaaatagttgttggtaatacaatgaaattatgtttagcttgcgaccatagaacg
gtagatggagcaacaggagcacaatttttacaaacattaaaaggatatattgaaaatcca
gttacaatgctagtataa

DBGET integrated database retrieval system