KEGG   Lacinutrix venerupis: BWR22_13565Help
Entry
BWR22_13565       CDS       T04680                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lvn  Lacinutrix venerupis
Pathway
lvn00620  Pyruvate metabolism
lvn00680  Methane metabolism
lvn01100  Metabolic pathways
lvn01120  Microbial metabolism in diverse environments
lvn01200  Carbon metabolism
Module
lvn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lvn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWR22_13565
  09102 Energy metabolism
   00680 Methane metabolism
    BWR22_13565
Enzymes [BR:lvn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BWR22_13565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APY01289
UniProt: A0A1P8RRJ6
LinkDB All DBs
Position
2999733..3002312
Genome map
AA seq 859 aa AA seqDB search
MPTQPKLTRFNQTVLSKYQIYNSIFMTLPFDTITKTGALLPLFHETCQKGFSKKDNPTTI
VETFFKKYQASRSKESQTNLLFQFIQYIERQVVLFDAIEDAAFPVVNNMDGIGTLRSLKE
SVTAENKLETLKKYLEEFKVRIVLTAHPTQFYPGSVLGIITDLTEAIRENDLLKINDLLA
QLGKTPFFKHEKPSPYDEAVSLIWYLENVFYKSFGTIYDYIQQNIFDGEHIENDIINIGF
WPGGDRDGNPFVTPEITLKVANRLRETVIKNYYRDIRRLKRKLTFKGVEDRITIIERELY
KIISYQESTLTLASFTKELKEIKNVIIEKHQSLYVTEINSLLNKIHLFGFHFANLDIRQD
SRKHEQYFNDMVNTLIENESNIFPKNYFDLSESEQVKLLSNVKGEVDLSLIKNEETLKAL
KTMKVLKSIQKTNGEVAANRYIISNNQTTLHVMQLFAMLKLVAFQDKLTVDVGPLFETIT
DLENAPKVMEELYTNPEYAAHLKARGNKQTIMLGFSDGTKDGGYLMANWAIYKAKENLTK
ISRQYGITVIFFDGRGGPPARGGGKTHNFYASLGPTIEDKEVQLTIQGQTISSNFGTLES
SQYNLEQLISSGIYNSLSDKDLSMVPENREVMTDLSERSYKAYSDFKAHPKFISYLEHMS
TLKYYAKTNIGSRPSKRGKAEGLVFEDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDN
NEFEKVQRLFKTSDFFKTLIENSMMSLSKSFFDLTKYMSEDPEYGEFWNIIYNEYETSKR
LLLKLTGYKELMQEEPAGKASIAVRESIVLPLLTIQQYALKKIQELEKATIKDEAQIRIY
EKLVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacaaccaaaacttacgcgatttaatcaaacagtattatcgaagtaccaaata
tacaatagtatatttatgacacttccttttgatactataacaaaaacaggagcgttgctt
ccgctctttcatgaaacttgccaaaaaggttttagcaaaaaagacaacccaacaactatt
gttgaaacgttttttaaaaaataccaagcaagtcgctctaaagaaagccaaacaaattta
ctatttcaatttattcaatatatagaacgtcaagttgttttatttgatgctatagaggat
gccgcatttcctgtagttaacaacatggatggcattggtactttgcgtagtttaaaagaa
agtgttactgcagaaaacaaattagaaacactaaaaaagtatcttgaagaatttaaagta
aggattgtgttaaccgcgcacccaacacaattttatcctggctctgttttaggtatcatt
acagatttaacagaagccattagagaaaacgatttacttaaaataaatgaccttttagca
caattaggtaaaacacctttttttaagcacgaaaaaccttcaccttacgacgaggctgtt
agtttaatatggtatcttgaaaacgtattttacaaatcttttggaactatatacgactat
atacagcaaaatatttttgatggagaacacatagaaaacgacataataaatattggtttt
tggcctggaggagatagagacggaaatccatttgttacaccagagataaccttaaaagta
gccaatagattacgagaaactgttattaaaaattattatcgagacataagacgcttaaaa
agaaaattaacttttaaaggcgtagaagacaggattactataatagaacgcgaattatac
aaaataatctcgtaccaagaatctacattaactttagcttcttttactaaggaattaaaa
gaaattaaaaatgttataatagaaaagcaccaatcgctttatgttaccgaaataaacagc
ttattaaataaaattcacctatttggatttcattttgcaaatttagacatacgtcaagac
agcagaaaacatgagcaatattttaacgatatggtgaatacgttaattgaaaatgaaagt
aatatttttccaaaaaattactttgatttatctgaatctgaacaagtaaaactactctct
aatgttaaaggcgaagtagatttatctctaattaaaaatgaagaaactttaaaagcactt
aaaacaatgaaggtgcttaaaagtatacaaaaaacaaatggagaagttgctgctaacaga
tacataattagtaacaaccaaacaacattgcatgttatgcaattatttgccatgcttaaa
ttagtagcctttcaagacaaactaactgtagatgttggacctttatttgaaactattacc
gatttagaaaatgctccaaaagttatggaggagctatacactaacccagaatatgctgca
catttaaaagctagaggaaataaacaaactataatgcttggctttagtgacggtacaaaa
gacggtggttatttaatggctaactgggctatatataaagctaaagaaaatttaaccaaa
atatctagacagtatggtattactgttattttctttgatgggcgtggtggacctccagct
cgaggtggtggaaaaacacacaatttctacgcatctctaggtccaactattgaagacaaa
gaagtacaattaaccatacaaggtcaaactatatcgtctaattttggaactttagaatcg
tcacaatacaacttagaacaactaattagctctggaatttacaacagtttaagcgataaa
gatttaagtatggttccagaaaatcgtgaggttatgaccgatttatctgaacgcagttat
aaagcatattctgattttaaagcacacccaaaattcatctcgtatttagaacatatgagt
actttaaagtattatgcaaaaacaaacattggtagccgtccatcaaaacgaggaaaagca
gaaggtttagtttttgaagatttaagagccatcccatttgtaggatcatggagccagtta
aaacaaaatgtacctggattttttggtgttggtactgctttaaaacattatgaagacaat
aatgaatttgaaaaagtccaacgcttatttaaaacatcagatttctttaaaacattaata
gaaaacagcatgatgtcactatctaaatcgttcttcgatttaacaaaatacatgagtgaa
gatcctgaatatggagagttttggaatataatttataatgaatatgaaacttcaaaacga
ctactattaaaacttactggctataaagaattaatgcaagaagaacctgccggaaaagct
tctattgctgtaagagaatctattgttcttcctctattaacaatacaacaatatgcgctt
aaaaaaattcaagagcttgaaaaagctactattaaagacgaagcgcaaataagaatttac
gaaaaattagttaccagatctttatttggaaatataaacgcaagtcgtaattctgcttaa

DBGET integrated database retrieval system