KEGG   Lacinutrix venerupis: BWR22_13935Help
Entry
BWR22_13935       CDS       T04680                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lvn  Lacinutrix venerupis
Pathway
lvn00564  Glycerophospholipid metabolism
lvn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lvn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BWR22_13935
Enzymes [BR:lvn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BWR22_13935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA HI0933_like Pyr_redox_3 Thi4 FAD_binding_3 GMC_oxred_N NAD_binding_8 YmcE_antitoxin
Motif
Other DBs
NCBI-ProteinID: APY01355
UniProt: A0A1P8RRM1
LinkDB All DBs
Position
complement(3100693..3102270)
Genome map
AA seq 525 aa AA seqDB search
MKKSVFKRETLINQLKATKNWDVIVIGGGATGLGVALDCTTRGYKTLLLEQVDFAKGTSS
RSTKLVHGGVRYLAQGNIDLVREALYERGLMLKNASHLVNDQSFIIPNYSYWDNLFYTIG
LKVYDFLSGKLSFGKSLRIKKSETISRLSTLKIDNLKGGVVYHDGQFDDSRLAVNIAQTC
IENGATVINHCKVKNLLKNEKGIVNGVVAVDVETNEEYALNAKTVINATGVFTDEVLKMD
DAALKNTIRPSQGIHLVFDKSFLPGNDAIMIPKTDDGRVLFLVPWHDKVVVGTTDTLLDS
HSLEPKPLDKEIDFILNTANRYLNKNVTKDDVLSIFAGLRPLAAPKDKSEKTKEISRSHK
IIVSESELVTITGGKWTTYRRMAQDTVNKIIELNKLPDAKCKTKQLLIHGANGTVDRSNH
MYIYGTDKVKVEQLIEEDATLSERLHPDLQFTKAEVVFAVRHEMARTIEDVLARRVRILF
LNAKAAIEIAPIVGELIRKELDQTTDWRSQQISNFIKVADQYVLK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
ataaaaaaaagcgtgtttaaaagagaaaccttaataaatcagttaaaagctactaaaaat
tgggatgttattgtcattggaggtggagctacaggattaggtgttgccttagattgtaca
acaagaggatataaaacattgcttttggagcaagtggattttgcaaaaggaacttctagt
agaagtactaaattagtacatggaggtgttaggtatttggctcaaggtaatatagacttg
gttagagaggctttgtacgaaagaggtttaatgttaaaaaatgcttcacatttagtaaat
gatcaatcgtttattataccaaattatagttattgggataatttattttatactattggt
ttaaaagtttacgattttctttccggaaaattaagctttggaaaatctttaagaataaaa
aaatctgaaactatttctaggttatcaacattaaaaatagataatttaaagggaggagta
gtttatcatgatgggcaatttgacgattctagattggcagtaaacattgcgcaaacttgt
attgagaatggtgccacagtaattaaccattgtaaagttaaaaaccttttaaaaaatgag
aaaggtatagttaatggtgttgtggcggttgatgtagaaacaaatgaagaatatgcttta
aatgctaaaactgtaattaacgcaactggagtatttacagatgaggttttaaaaatggat
gatgctgcattaaaaaatacaattcgtccaagtcaaggtattcatctggtttttgataaa
tcgtttctaccaggaaatgatgcgattatgattccaaaaacagatgacggtcgtgtactg
tttttagttccatggcatgataaagttgtagttggtacaacagatactttattagatagc
catagtttagagccaaaaccattagataaagagattgattttattttaaatactgcaaat
agatatttaaacaagaatgttactaaagatgatgtattaagcatatttgcgggtttaaga
cctttagctgcacctaaggataagtctgaaaaaacaaaggagatttcaagaagccataaa
attatagtttcggagtccgagttggttaccataactggaggtaaatggactacttatagg
cgcatggctcaagacacagttaataaaataatagaattaaataaattaccagatgctaag
tgtaaaacaaaacaattattaattcatggagcaaatggtactgtagatcgatcaaatcac
atgtatatatatggaacagataaagtaaaagtagagcagctaatagaggaggatgctact
ttatctgaaaggttgcatccagatttgcaatttactaaagcagaagttgtttttgcagta
agacacgaaatggctagaactattgaagatgttttagcaagaagagtacgaattctgttt
ttaaatgctaaagcagcaatagaaatagctccaattgttggagaattaattagaaaagaa
ttagaccaaacaacagattggagaagtcaacaaatttcaaattttataaaagttgcagac
caatatgtcttaaaataa

DBGET integrated database retrieval system