KEGG   Yoonia vestfoldensis: LOKVESSMR4R_00461Help
Entry
LOKVESSMR4R_00461 CDS       T04854                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00240  Pyrimidine metabolism
lvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LOKVESSMR4R_00461 (tdk)
Enzymes [BR:lvs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LOKVESSMR4R_00461 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_19
Motif
Other DBs
NCBI-ProteinID: ART99799
UniProt: A0A1Y0E8R8
LinkDB All DBs
Position
complement(457528..458151)
Genome map
AA seq 207 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASHNYIERGMQTYLMIAQLDHRAGRGRIGSRIGIGADAD
TFAPGEDLFAKIKARLDSGPCACVFIDEAQFLDPDQVWQLARAVDDLGVPIMTFGLRVDF
LGALFPGSAALLALADEMREVRTICHCGKKATMVVRKDAQGRVMTAGDQIVIGGNDRYVS
LCRRHWRQEMGEVVPEKKNFSASGGDI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttatttcaattattccaccatgaatgcgggcaaatcgactgtcttgttg
caggcgtcgcataattacatcgaacgcgggatgcagacctatctgatgatcgcgcagctg
gatcatcgcgccgggcgtggccggatcggcagccggatcgggattggtgccgatgccgat
actttcgcccccggcgaggatctgtttgccaagatcaaggcccggctggactctggcccc
tgcgcctgcgtcttcatcgacgaggcgcaatttctggaccccgatcaggtctggcaactg
gcccgcgcggtggatgatctgggcgtgccgatcatgacttttggcctgcgcgtggatttt
ctgggcgcgctgtttcccggctctgccgcgctgctggcgctggcggatgaaatgcgcgag
gtccgcacgatctgccattgcggcaagaaggcgacgatggttgtgcgcaaggatgcccaa
ggccgcgtgatgacagccggcgaccagatcgtcattggcgggaatgatcgctatgtgtcg
ctctgccgtcgtcactggcggcaggaaatgggcgaggtcgtgccggaaaagaaaaacttt
tcagcctccggcggggatatttag

DBGET integrated database retrieval system