KEGG   Yoonia vestfoldensis: LOKVESSMR4R_00508Help
Entry
LOKVESSMR4R_00508 CDS       T04854                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00071  Fatty acid degradation
lvs00280  Valine, leucine and isoleucine degradation
lvs00281  Geraniol degradation
lvs00310  Lysine degradation
lvs00362  Benzoate degradation
lvs00380  Tryptophan metabolism
lvs00410  beta-Alanine metabolism
lvs00640  Propanoate metabolism
lvs00650  Butanoate metabolism
lvs00903  Limonene and pinene degradation
lvs00930  Caprolactam degradation
lvs01100  Metabolic pathways
lvs01110  Biosynthesis of secondary metabolites
lvs01120  Microbial metabolism in diverse environments
lvs01130  Biosynthesis of antibiotics
lvs01200  Carbon metabolism
lvs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LOKVESSMR4R_00508 (fadJ)
   00650 Butanoate metabolism
    LOKVESSMR4R_00508 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOKVESSMR4R_00508 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOKVESSMR4R_00508 (fadJ)
   00310 Lysine degradation
    LOKVESSMR4R_00508 (fadJ)
   00380 Tryptophan metabolism
    LOKVESSMR4R_00508 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LOKVESSMR4R_00508 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LOKVESSMR4R_00508 (fadJ)
   00281 Geraniol degradation
    LOKVESSMR4R_00508 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOKVESSMR4R_00508 (fadJ)
   00930 Caprolactam degradation
    LOKVESSMR4R_00508 (fadJ)
Enzymes [BR:lvs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LOKVESSMR4R_00508 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LOKVESSMR4R_00508 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LOKVESSMR4R_00508 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 DAO UDPG_MGDP_dh_N NAD_binding_2 MotA_ExbB 2-Hacid_dh_C FAD_binding_3 Pyr_redox_2 F420_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ART99846
UniProt: A0A1Y0E8A4
LinkDB All DBs
Position
complement(506832..509024)
Genome map
AA seq 730 aa AA seqDB search
MTDFTLKTDADGVAVITWDTIGKSMNVMNQQGFTDLDALIDQALADDAVKGIIITSGKDG
SFAGGMDLNIIARMKDSAGDDPARGLFDGVMAMHGVLRKIERAGMDPKTNKGGKPIAAAL
PGTALGIGLEIPLACHRIFATDNPKAKIGLPEIMVGIFPGAGGTTRLVRKLGAMAASPLL
LEGKLNDPQGAKRAGVVDEVVADPVAAAKEWILSNPSIVKPWDEKGYKMPGGAPYHPAGF
MTFVGASAMVNGKTMGVYPAAKALLSAVYEGALVPFDTALKIEARWFTNILMNPSSSAMI
RSLFINKEALEKGANRPDAPDQKVKQVGVIGAGMMGAGIALVSALAGIKVVLIDAKQEAA
DKGKSYTAAYMDKGIARKKATEDKKAAVLGLINATTDYAALKDCDLIVEAVFEDVGVKAE
VTKKVQAVTGPDCIFATNTSTLPITELAKASNDPANFIGIHFFSPVDKMMLVEIIKGEAT
GDVAVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVREGVEPALIENAAKL
VGMPLGPLQLVDETSIDLGVKIAKATRAAMGDAYPDGAVDEVLFWMADQNRLGRKSNAGF
YAYDDKGKRLGLWDNLAAQYPVADDQPDLVTVQHRLLFAQVLEAVRALEDGVLTDIREGD
VGAILGWGFAPWSGGPFSWLDIIGAPYAAERCDQLTAEFGDRFSAPDLLRDMADKGQEFY
KRFATGAKAA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttcacacttaaaaccgacgccgatggcgtggcagtcatcacttgggacaca
atcggcaaatccatgaatgtgatgaaccagcaagggttcaccgatctggatgcgctgatt
gatcaggctctggcggatgatgccgtcaaaggcatcatcatcacatcgggcaaggacggg
tcttttgccgggggtatggacctgaacatcatcgcgcggatgaaagacagcgccggtgat
gatcccgcgcgcgggctgttcgacggcgtgatggcgatgcatggcgttttgcgcaagatc
gaacgcgcgggcatggacccaaagaccaacaaaggcggcaagcccatcgccgccgccctg
cccggcacggcactgggcatcgggctggaaatcccgctggcctgtcaccgcatctttgcc
accgataaccccaaggcgaaaatcggcctgcccgaaatcatggtcggcattttccccggt
gccggtggcacgacgcgtctggtgcgcaagctgggggccatggccgcatcacccctgttg
ctcgaaggcaagctgaacgatccgcaaggggccaaacgtgcaggcgtggtcgacgaggtt
gtggccgaccctgtcgccgccgccaaggaatggatcctttcgaacccgtccatcgtcaaa
ccctgggacgaaaagggttataaaatgcccggtggcgcgccctaccatccggccggtttc
atgacctttgtcggcgcatctgccatggtcaacggcaagacgatgggggtctatcctgcc
gcgaaagccttgctatcggcggtctatgaaggggccttggtgcctttcgataccgcgctg
aagatcgaggcgcgctggttcaccaatatcttgatgaaccccagctcctcggccatgatc
cgcagcctgttcatcaataaggaagcgctggaaaaaggcgccaaccgccctgatgcgccc
gatcaaaaggtcaaacaggtcggtgtcatcggcgcgggcatgatgggggcgggcatcgcg
ctggtctctgcgcttgcaggcatcaaggtcgtgctgatcgacgccaaacaagaggccgcc
gacaaaggcaaatcatatactgccgcttacatggacaaaggcatcgcccgcaaaaaggcg
accgaggacaagaaagccgccgtgttggggctgatcaacgccacgaccgattatgccgcc
ttgaaagattgcgatctgatcgtcgaggccgtgttcgaggatgtgggcgtcaaggccgag
gtcaccaagaaggtgcaggcggtgacgggtcctgactgcatctttgcgaccaacacatcg
accctgccgatcaccgaactggccaaagccagcaatgatccggcgaatttcatcggcatc
catttcttttcccccgtggacaagatgatgctggtcgagatcatcaaaggcgaggcaaca
ggcgatgtcgcggtggccaaagcgctcgatttcgtgcgccagatccgcaagacgccgatc
gtggtcaatgacgcgcggttcttctacgccaaccgctgcatcattccttatatcaacgaa
ggcatccgcatggtccgcgaaggggtcgaacccgccctgatcgaaaacgcggccaaactg
gtcggcatgccgctgggtccgctgcaattggtggatgaaaccagcatcgatctgggcgtg
aaaatcgccaaggcgacgcgcgccgcgatgggcgatgcctatcccgacggtgcggtggac
gaggtgctgttctggatggccgatcaaaaccgtctgggccgcaaatccaatgccggtttt
tatgcctatgacgacaagggcaagcgccttggcctctgggacaatctggccgcgcaatac
cctgtcgcggatgaccagcccgatctggtgaccgtgcagcaccgcctgctgttcgcccaa
gtgctggaagccgtgcgcgcgctggaagacggcgtgctgaccgatatccgcgaaggcgat
gtcggcgcgatccttggctggggctttgcgccttggtcgggcgggccgttcagctggctg
gatatcatcggcgcgccctatgccgccgaacgctgcgaccagttgaccgcagaattcggg
gatcggttcagcgcgcctgacctgctgcgcgacatggccgataaggggcaggagttttac
aaacgcttcgccaccggcgcgaaagcggcctga

DBGET integrated database retrieval system