KEGG   Yoonia vestfoldensis: LOKVESSMR4R_01695Help
Entry
LOKVESSMR4R_01695 CDS       T04854                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00010  Glycolysis / Gluconeogenesis
lvs00020  Citrate cycle (TCA cycle)
lvs00620  Pyruvate metabolism
lvs01100  Metabolic pathways
lvs01110  Biosynthesis of secondary metabolites
lvs01120  Microbial metabolism in diverse environments
lvs01130  Biosynthesis of antibiotics
lvs01200  Carbon metabolism
Module
lvs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOKVESSMR4R_01695 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LOKVESSMR4R_01695 (pdhC)
   00620 Pyruvate metabolism
    LOKVESSMR4R_01695 (pdhC)
Enzymes [BR:lvs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LOKVESSMR4R_01695 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF1152 ATP-synt_ab_Xtn QRPTase_N DUF2118
Motif
Other DBs
NCBI-ProteinID: ARU01009
UniProt: A0A1Y0EC91
LinkDB All DBs
Position
1709419..1710750
Genome map
AA seq 443 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWHVKEGDKVSSGDILAEIETDKATMEFEAVDEGVMGKIM
IAEGTEGVKVNDVIAVLLEDGESADDIEAPAQARDAAPAKENTPAPAHTPAPAPAPAPAP
GPQAATPAAPTPTKDTTRVFASPLARRIAADKGLDLANVTGSGPHGRIVKADVESAKAGA
TPAAAAAPKADAPKAAAMASGPSTEAVIKMYDGRPFEEVKLDGMRKTIAARLTEAKQSVP
HFYLRRDINLDALMALRGQINAQLDGRGVKLSVNDFIIKACALALQQVPEANAVWAGDRT
LKFSKSDVAVAVAIEGGLFTPVLRDAEMKSLSALSSEMKDLASRARDRKLAPQEYQGGSF
AISNLGMFGVDNFDAIINPPHAAILAVGAGVKKPIVGKDGALAVATIMSVTLSVDHRVID
GALGAILLQAIKDNLENPLTMLA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagaaattctgatgcccgccctgtcgccgacgatggaggaaggcacgctggcc
aaatggcatgtcaaggaaggcgacaaggtctcctcgggcgatatcctcgccgagatcgag
accgataaggccacgatggaattcgaggccgtggatgaaggggtgatgggcaagatcatg
atcgccgaaggcaccgaaggcgtcaaagtcaacgatgtgatcgcggtcttgctggaggat
ggcgagtctgccgatgatatcgaggccccggctcaagcccgggatgcggcccccgcaaaa
gagaacaccccggcccccgcgcacaccccggcccccgcgcccgccccggcccccgcgccg
gggcctcaggcagcaacacccgccgcccccacccccaccaaagacaccacccgcgtcttc
gcctcgcccctcgcccgccgcatcgcggcggacaaaggcctcgatctggcaaatgtgacc
ggctctggcccgcatggccggatcgtcaaagccgatgtcgaatccgccaaagccggggcc
acacccgccgcggcagccgcgccaaaggccgatgcccccaaagccgccgccatggccagc
ggtcccagcaccgaggctgtcatcaagatgtatgacggccgccccttcgaggaggtcaag
cttgacgggatgcgcaagaccatcgccgcccgcctgaccgaagcgaaacaatcggtgccg
catttctatctgcgccgcgatatcaatcttgatgcgctgatggccttgcgtggccagatc
aacgcccagcttgacgggcgcggcgtgaaactgtcggtcaatgatttcatcatcaaggcc
tgcgcgctcgcgctgcaacaagtgcccgaggccaatgccgtctgggcgggcgaccggacg
ctgaaattcagcaaatccgatgtggccgtggctgtcgccatcgaaggcgggctgttcacg
ccggtgctgcgcgatgcagagatgaaatcgctctcggcgctgtcatccgagatgaaagac
ctcgccagccgcgcgcgtgaccgcaagctggcgccgcaggaataccagggcggcagtttc
gcgatttccaaccttggcatgttcggcgtcgataattttgacgcgatcatcaacccgccc
catgccgccatcctggccgttggcgcaggcgtcaaaaagcccatcgtgggcaaggacggg
gccttggcggtcgctacgatcatgtctgtcacgctctcggtggatcaccgcgtgatcgac
ggggccctgggcgcgatcctgctgcaggcgatcaaggataatctggaaaacccgctgacg
atgctggcctga

DBGET integrated database retrieval system