KEGG   Yoonia vestfoldensis: LOKVESSMR4R_02112Help
Entry
LOKVESSMR4R_02112 CDS       T04854                                 

Gene name
dddL
Definition
(GenBank) putative dimethlysulfonioproprionate lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00920  Sulfur metabolism
lvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    LOKVESSMR4R_02112 (dddL)
Enzymes [BR:lvs01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     LOKVESSMR4R_02112 (dddL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2 6PGD AraC_binding
Motif
Other DBs
NCBI-ProteinID: ARU01420
UniProt: A0A1Y0ED62
LinkDB All DBs
Position
complement(2118428..2119090)
Genome map
AA seq 220 aa AA seqDB search
MTNTMTTIKGLPDWRYLLAEFYELYRAIPAGGSDRIRSHQRQVREAINRVIKAHAPVQLQ
PAAQKPVTAHLRRALDQGRSGIMASTIRALDTLSVDFSWQYGYEKVPPSLAGSYAYAEIA
GPNGPVITSEIILGVVLFAPGCTYPAHAHQGITESYVCLSGAVSENHQGVYVPGSMIFNP
PDHLHRITVGDREPALLAYAWLGKPADLAGQKMVFSRPRK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacacaatgaccacgatcaagggcttgccggattggcgctatctgctggcggaa
ttctacgagctttaccgcgcgatccccgcgggcggcagcgatcgcatccgcagccatcaa
cgccaggtgcgcgaggcgatcaaccgcgtgatcaaggcacatgcgcccgtgcaattgcag
cccgccgcgcagaaacctgtcaccgcgcatctgcgccgggcgctggatcaggggcgctcg
gggatcatggcctcgacgatccgggcgcttgatacgctcagcgtggatttttcctggcaa
tatggctatgaaaaggtccccccgtcgctggccggttcctatgcttatgccgaaatcgca
gggccgaacgggccggtcatcacctcagagatcatcctgggcgtggtgttattcgcgccc
ggctgcacctatccagcccatgcgcatcaggggatcaccgaaagctatgtctgcctgtcg
ggcgccgtgtccgagaatcaccaaggcgtctatgtgcccggctcgatgatctttaacccg
ccggatcatctgcacaggatcaccgtgggcgaccgtgaacccgcattgctggcctatgcc
tggctgggcaagcccgccgatctggccgggcaaaagatggtcttttcgcgcccgcgcaaa
tag

DBGET integrated database retrieval system