KEGG   Listeria welshimeri: lwe1839Help
Entry
lwe1839           CDS       T00422                                 

Definition
(GenBank) protein kinase, putative
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lwe  Listeria welshimeri
Brite
KEGG Orthology (KO) [BR:lwe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lwe01001]
    lwe1839
Enzymes [BR:lwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     lwe1839
Protein kinases [BR:lwe01001]
 Serine/threonine kinases: Other
  Bacterial family
   lwe1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Haspin_kinase Kdo RIO1 Kinase-like Seadorna_VP7 DUF5383
Motif
Other DBs
NCBI-ProteinID: CAK21257
UniProt: A0AJS5
LinkDB All DBs
Position
complement(1867449..1869416)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLNDRYKILHAIGGGGMANVYLAHDMILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSIYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKSVDIMLQIVS
AVTVAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQAEIPSAREQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKERLNEPKYIFPTDDGDTKTIPIIATKE
AMQNLDKTIVPEGKVAAQEVASDATKGKKKKKMSKKKKIAWIVFSVIIVFIIGILLLWLL
GKSPDEIAVPDVSGKTEDQAIALLQKEGFVIGKTAEKNSDEVEEGKVINSDPEAGEMKEK
GTKVNLFVSIGSKKITLDDYSGRSYSDTKALLEEQGFESISAEEEYSSDVDKGMIISQTP
SGGSEVVAKSTSVKFVVSKGAEPISLKDLRGYTKTAVEDYASPLGFKVSSTEENSSSVEK
GQVISQSPSAGTTMNPGDTIQIVISAGPKEKEVKEVTKTFNIPYTPSDEENPEPQHIQIY
IQDKDHSMTSAYREMDISQNTSVEVTFKIEEGSSGGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgataggtaaacgcctaaacgatcgttataagattttacatgctataggcggcggt
ggaatggccaatgtttatcttgctcatgacatgatccttgaccgcgatgttgcagtgaaa
attttacgaattgatttagctgatgaaagtaatttaattcgtcgtttccaaagagaagcg
caatctgcaactagtttagttcatccaaatattgtgagtatctatgatgttggtgaagag
aatgatttacactacattgttatggaacatgtagatggcatggatttaaaacaatatatt
catgaaaatcatcctattagttatgaaaaatcagtggatattatgctacaaattgtttca
gcagttaccgtcgcacatcaacatcacataattcaccgcgatttaaaaccacaaaatatc
ttaattgatcatgatggagtcgtgaaaattaccgattttgggattgcaatggcgttgtct
gaaacatctataacccagactaattcattacttggctctgttcattacttatctccagaa
caagcccgtggcggcatggcaacacaaaaatcagacatctattcacttggaatcgtttta
tacgaactactaactggaaaagtaccttttgatggtgaatccgccgtttctattgccatt
aaacatttacaagcggagattccttctgcaagagaacagaatccagaaatacctcaaagt
ctagaaaatattattattaaagccacagcgaaagatccatttttacgttatcaaaatgca
gaagaaatggaaaaagatttacaaacctgcttaaataaagaacgcttgaacgaaccaaaa
tatatatttccaacagacgatggggatacaaaaaccattcccatcattgcgactaaagaa
gccatgcaaaatctcgataaaactattgtcccagaaggaaaagtagccgcacaagaagtt
gcttccgatgcaactaaaggaaagaaaaagaaaaaaatgagcaagaaaaagaaaattgct
tggattgtattttcagtgataatcgtgtttattattgggattttattattatggttatta
ggtaaaagtcctgatgaaatagcggtcccagatgtttctggtaaaacagaagaccaagcc
atcgcactgcttcaaaaagaaggatttgttattggcaaaacagctgaaaaaaatagtgat
gaagtagaagaaggaaaagtaattaattctgatcctgaagctggtgaaatgaaagaaaaa
ggaacgaaagtcaatttatttgtaagtatcggttctaaaaaaattacattagatgactac
agcggaagaagttactctgataccaaagctttactagaagaacaaggatttgaaagtatt
tctgcggaggaagagtatagttcagatgtggacaaaggaatgattataagccaaacacct
tcaggcggatcagaagtcgtagccaaatctactagcgtgaagtttgtcgtaagtaaaggc
gcagagccaatttctcttaaagacttacgtggttatacaaaaacagcggtagaagattat
gcttctcctcttggatttaaagtatctagcacagaagaaaactcaagttctgttgaaaaa
ggacaagtgatttcgcaatcaccatctgctggaaccacgatgaatccgggcgatacaatc
caaatcgttatttctgctggaccaaaagaaaaagaagtgaaagaagtaacgaaaacattc
aatattccttatacaccaagcgatgaagaaaacccagaaccgcaacatatccaaatttat
attcaagataaagatcacagtatgacaagtgcttaccgtgaaatggatattagccaaaat
acatctgtagaagtaactttcaaaatagaagaaggttctagcggcggttataaaatcatc
agtgacgataaagtaatcgatgaaggtacagtcccttatccaaactaa

DBGET integrated database retrieval system