KEGG   Listeria welshimeri: lwe2381Help
Entry
lwe2381           CDS       T00422                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lwe  Listeria welshimeri
Pathway
lwe00250  Alanine, aspartate and glutamate metabolism
lwe00410  beta-Alanine metabolism
lwe00430  Taurine and hypotaurine metabolism
lwe00650  Butanoate metabolism
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    lwe2381 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lwe2381 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lwe2381 (gadB)
   00430 Taurine and hypotaurine metabolism
    lwe2381 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lwe2381 (gadB)
Enzymes [BR:lwe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     lwe2381 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAK21799
UniProt: A0ALB7
LinkDB All DBs
Position
complement(2419598..2421001)
Genome map
AA seq 467 aa AA seqDB search
MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAELLMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKEMSYLGT
STVGSSEACMLGGLAMKFRWRNNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKEHLSLDVDKVFELVDEYTIGIVGILGITYTGKFDDIALLDERVEAYNATNEHQL
VIHIDGASGAMFTPFVNPELSWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRFGFEGYREIHEKTKKTALYLAKTVE
KSGYFDIINDGSNLPIVCYKLKEGLDIEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFAEALHNLEHARVLYHDKGRNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaaaacgacaagcgaaaacatgaaagttatcgaatcccgctctttgga
tctgaagaagaaagcacaagtattccaaaatatgtattaaagaaggagccaatggaacca
cgcattgcataccagctagtgaaagaccaactgatggatgaaggaaatgcacggcagaat
ttggcaactttttgtcagacatatatggaaaaagaggcagaattactgatggcagaaacg
ctcgagaaaaatgccattgataaatctgagtaccctcaaacagctgaactggaaaatcgc
tgtgttaatattttagcggatttatggaatgcaccaaaagaaatgtcttacttaggaact
tctactgtaggatcttcagaggcgtgtatgcttggcggtttagcgatgaagttccgctgg
cgtaataatgcagaaaaacgtggtctagatattcaggcaaaacgaccaaacttaattatt
tcctcaggatatcaagtctgttgggaaaaattttgtgtgtactgggatgttgacatgcgg
gttgtcccgatggataaagaacatcttagccttgatgtggacaaggtgtttgagttagtc
gatgaatatacgattggaattgttggtattttaggtattacttatacaggtaaatttgat
gatatagctttacttgatgaacgagtagaagcttataatgcgacaaacgaacatcaatta
gtgattcatattgacggggcaagtggtgcgatgtttactccatttgtcaatccagaatta
tcatgggattttcgccttaaaaatgtggtttcgataaacacttctggtcataaatatggt
ttagtatatccgggtgttggttggattttatggaaagataaagaatatttaccaaaagaa
cttatttttgaagtgagttatttgggtggttcgatgccaacgatggcgattaatttttcg
cgtagtgcaagccaaattattggtcagtattataatttcttgcgttttggttttgaaggt
taccgagaaattcatgaaaaaacaaagaaaacggctctttatcttgcaaaaacggtagaa
aaaagtggctactttgacattattaatgatggttctaatttaccaatcgtctgttataag
ttaaaggaaggattggatatcgagtggacgttgtatgaccttgctgaccaattgttgatg
aaagggtggcaagtaccggcgtatccactgccagctgatttaagtgatacaattattcaa
cgatttgtttgccgagctgatttaggttataatgtggccgaagaatttgctgctgatttt
gcggaagcacttcataatttagaacatgctagagttctttatcatgacaaaggacgaaat
gattcttacggttttacgcattaa

DBGET integrated database retrieval system