KEGG   Listeria weihenstephanensis: UE46_02800Help
Entry
UE46_02800        CDS       T05637                                 

Definition
(GenBank) permease
  KO
K07090  uncharacterized protein
Organism
lwi  Listeria weihenstephanensis
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    UE46_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE TAF6_C
Motif
Other DBs
NCBI-ProteinID: AQY50080
UniProt: A0A1S7FRQ3
LinkDB All DBs
Position
complement(595112..595951)
Genome map
AA seq 279 aa AA seqDB search
MDIYQIFALLLIAIFAGVLGSILGLGGGIIVTPALTLLFGIDIKYAIGASIISVIATSSG
SAIAYIKDRITNLRVGMFLEIATTLGAVTGAFIGGLISATALYMIFGFLLLYSAITMIKK
VGSEFPTNVKPDPIATKLRLHDTYYDKALKKQVDYEVANVPAGFGVMYGAGIASGLLGIG
SGAFKVMALDVFMKMPLKVSSATSNLMMGVTAAASATVYLFRGDIDPLIAGPVAIGVLIG
ATIGTRIMQRLKSKVIRLVFIPVLIYVALQMILEGLGWI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttggacatctatcaaatttttgcacttttactcatcgctatttttgcaggagtgcttgga
tcaatactcggtcttggtggtggaattatcgtcacacccgcacttacactcctatttggc
atcgatatcaagtatgccattggcgccagtatcatttccgtcatcgccacaagtagtggt
tcagcaattgcctacataaaagatcgaattacaaatttacgtgttggtatgtttctagaa
atcgcaacgacgcttggagccgtgaccggggcgtttattggcggacttatctccgcaaca
gcactctacatgatctttggttttcttttattatattctgcaattacaatgatcaaaaaa
gtaggctcagaattcccaactaatgtgaagccagaccctatcgcaacaaaactgcgtctt
catgatacttactatgataaagcgctaaaaaaacaagtcgattatgaagtcgcaaacgtg
cctgctggatttggcgttatgtatggcgcagggattgcaagtggcttacttggtatcgga
agtggagcgtttaaagtgatggcgctcgatgttttcatgaagatgccactcaaagtttct
agtgccacgagtaatttaatgatgggcgtaactgccgcggcaagtgccactgtttattta
ttccgcggtgacatcgatcctctaatcgccggtcccgtcgcaattggtgttttaatcggc
gccacaatcggaacaagaattatgcaacgtctaaaaagtaaagttatccgtctcgtattt
attcccgtcctgatttacgttgccttgcaaatgattttagaaggattggggtggatctag

DBGET integrated database retrieval system