KEGG   Listeria weihenstephanensis: UE46_04675Help
Entry
UE46_04675        CDS       T05637                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00260  Glycine, serine and threonine metabolism
lwi00261  Monobactam biosynthesis
lwi00270  Cysteine and methionine metabolism
lwi00300  Lysine biosynthesis
lwi01100  Metabolic pathways
lwi01110  Biosynthesis of secondary metabolites
lwi01120  Microbial metabolism in diverse environments
lwi01130  Biosynthesis of antibiotics
lwi01210  2-Oxocarboxylic acid metabolism
lwi01230  Biosynthesis of amino acids
Module
lwi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
lwi_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UE46_04675
   00270 Cysteine and methionine metabolism
    UE46_04675
   00300 Lysine biosynthesis
    UE46_04675
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    UE46_04675
Enzymes [BR:lwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     UE46_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT SecD-TM1 DUF5376
Motif
Other DBs
NCBI-ProteinID: AQY50392
UniProt: A0A1S7FSM8
LinkDB All DBs
Position
complement(982336..983691)
Genome map
AA seq 451 aa AA seqDB search
MKVIKFGGSSLASATQLQKVYKIVVDDPKRKFVVVSAPGKRFADDVKVTDLLIDCGAKHL
LGEAASDLEEAVLARYASIADELGLGEEVMARITRDFTELLNSDKTNPDRYMDRIKASGE
DNNAKMIAAFFRRQGTEAHYVNPKDAGLFVTDEPGNAQVLPESYDNLYKLLDRDGIVVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGVKAEVYENFTDVDAVYAVNPSIVHKPNAIVE
LTYREMRELSYAGFSVFHDEALVPAFQAGIPVQIKNTNRPELPGTRVIHRRENTNGPVVG
IASDGGFCSIYITKYLMNREIGFGRKVLEILEDADLTYEHMPSGIDDLTIILRENQMDRQ
TETTVLDRLKNELASDEVIIEHGIALVMVVGEAMKHNVGTTARASKALSEAHVNIEMINQ
GSSEVSIMFGVKEDQEKKAVRALYNEFFDAK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttattaaattcggcggaagttcgctggcctcggctacgcaactacaaaaagta
tacaaaatcgtggtagatgatccaaagcgaaagttcgttgttgtatctgctcctggtaag
cgttttgcagatgatgtgaaggtaacagatttattaattgattgtggcgcgaaacatctc
ttgggtgaagcggcgtcagatttggaggaggcagtccttgcccgctatgcatcgattgca
gacgagcttgggcttggtgaggaagttatggcgcgaattacacgagatttcacggaactt
cttaattcagataagacaaacccagaccgctatatggaccggattaaggcgagtggcgag
gataataatgcgaaaatgattgctgcatttttccgacgtcaaggcaccgaggcgcactat
gtcaacccgaaagatgctggactttttgtgacggatgaaccgggaaatgcgcaggttttg
ccagagagttatgataacttgtacaagttgttggaccgcgatgggatcgttgttttccca
gggtttttcggttacacgaaggatggcgaaatcagcacgttttcgcgcagtggctcagat
attacgggtgcaattgtggcgaatggcgtgaaggccgaagtttatgagaatttcacagat
gttgatgctgtgtatgcggtgaacccatcgatcgtgcataaaccgaatgcgattgtcgaa
ctaacgtatcgcgaaatgcgagagctatcttatgctggtttttccgtgtttcatgatgaa
gcgctcgttccagccttccaagcagggattcctgtgcaaattaaaaatacgaatcgtcct
gaattgcctggtacgcgcgtgattcaccgtcgcgaaaacacgaatggccctgttgttggg
attgcgagtgatggcggtttttgcagcatttacattacgaaatatttgatgaaccgcgag
atcggatttgggcgtaaagtattggaaattcttgaagacgccgatttgacctacgagcat
atgccttctggtatcgatgatttgacgattattttgcgagaaaatcagatggaccgtcaa
accgaaaccactgttttggatcgtttgaaaaatgagctggcatctgatgaggtaattatt
gaacatggcatcgcgcttgtgatggtcgttggagaagcgatgaaacataacgtcggaaca
accgcgcgagcttcgaaggctttgtctgaggcgcacgtcaacattgagatgattaaccaa
ggttcttccgaggtcagcattatgtttggcgtgaaggaagatcaggagaaaaaagcagta
cgtgcgctatataatgaattttttgacgcaaaataa

DBGET integrated database retrieval system