KEGG   Listeria weihenstephanensis: UE46_08055Help
Entry
UE46_08055        CDS       T05637                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00564  Glycerophospholipid metabolism
lwi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UE46_08055
Enzymes [BR:lwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     UE46_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_oxidored Pyr_redox_2 Pyr_redox FAD_binding_3 Thi4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AQY51001
UniProt: A0A1S7FU76
LinkDB All DBs
Position
1659095..1660765
Genome map
AA seq 556 aa AA seqDB search
MVQLFSAFDRETIQTKMTEETFDLVIVGGGITGAGIALDAVSRGMSVALIEMQDFAAGTS
SRSTKLVHGGLRYLQQFQVKEVAELGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKLSA
SFGIRLYDYLAGVKKEERRKILSAKETLAKNPFVKKEGLKGSGYYVEYRTDDARLTIEVM
KKAVELGAKVINYTKAENFLYDDKKHVVGVVARDLITGKVFDISGRRVINAAGPWVDRVR
KMDYTTNNKHLRLTKGIHLVIDKTKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEMVINPKANEEDHKYVIKAINYMFPDVNISENDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDEVSKPLAKESGKKFKPVQTHHLAISGGDVGG
SDNIDAFIEKKAKEGNNRFGWSLEEGRELAKRYGSNIDHVFTYAQEHKENGTSPLPNSLF
AQLHYAIYQEAVIHPVDFLLRRTGYLLFDMPYLLEWKDEVIADMDHLFQWDAQTKEQLVS
ELQTQIDDAREPADWH
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattttcagcattcgacagagaaacgattcaaacaaaaatgacggaggaa
acatttgatctagttattgtaggtggcggtattacaggtgcaggtattgcacttgatgct
gtctctcgtggcatgagtgtcgcgttgattgaaatgcaagatttcgcagcagggacatca
agtcgctctacgaaacttgtacacggtggtttgcgctatttacaacaattccaagtgaaa
gaagtcgcagagctaggaaaagaacgcgcgattgtgtatgaaaatgggccgcacgtaaca
actccagagtggatgatgttaccgtttcataagggtggaaatatgggcaaacttagcgca
tctttcggtattcgtttatacgactacttagcaggtgttaaaaaagaggaacgccgtaaa
attttatctgcaaaagaaacgctagctaaaaacccatttgtgaaaaaagaaggtttaaaa
ggttccggatattatgtggaataccgtacggatgacgcccgtttaaccattgaagttatg
aaaaaagcggtggagttaggcgcaaaagttattaattatacgaaagcggaaaacttcttg
tatgacgataaaaaacatgtcgttggtgtggtagcacgcgacctaattacaggtaaagtt
tttgatattagtggacgtcgcgtgattaatgccgcaggaccttgggtggatcgcgttcgt
aaaatggactacacaacaaacaataagcatcttcgtttaacgaaaggtattcacttagtt
attgataaaacgaaattcccgatggagcaggcagtttattttgatacacctgatggccgc
atggtttttgctattcctcgtgataagaaagtctacgtgggaacaacagataccgtgtac
gatgaaatggtcatcaatcctaaggcgaacgaagaagatcataaatacgtaattaaagcg
attaactatatgttcccagacgtcaacattagtgaaaatgacattgaatcaagctgggct
ggcgtccgtccgttgatttatgaagaaggaaaagatccctctgaaatttcgcgtaaagat
gaggtttggttctctgaaagtggcctaatcacgatggccggtggtaaattaacaggatat
cgtaaaatggcagaaaaactgttagatgaagttagtaaacctttagcaaaagaatcagga
aagaaattcaaaccagtacaaacgcatcatttagcgatttctggtggtgacgtcggtggc
tcggataatattgacgcctttattgagaaaaaagcgaaagaaggaaataatcgttttggt
tggtcactggaagaaggtcgtgaattagctaaacgttatggctcaaatatcgatcatgtt
ttcacttacgcacaagagcataaagaaaatggaacatcaccgctaccaaatagtttattc
gcgcaactccattatgccatttatcaagaagcggtcattcatccagtggatttcttgctt
cgtcgcacgggttatctgttattcgatatgccttacttgttggagtggaaagacgaagtg
atcgcggatatggatcatttattccaatgggatgcgcagaccaaagaacaattagtttca
gaattgcaaacacaaattgatgatgcacgcgaacctgctgactggcattaa

DBGET integrated database retrieval system