KEGG   Listeria weihenstephanensis: UE46_09460Help
Entry
UE46_09460        CDS       T05637                                 

Definition
(GenBank) hypothetical protein
Organism
lwi  Listeria weihenstephanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Post_transc_reg Act-Frag_cataly
Motif
Other DBs
NCBI-ProteinID: AQY51258
UniProt: A0A1S7FUZ4
LinkDB All DBs
Position
complement(1956053..1956340)
Genome map
AA seq 95 aa AA seqDB search
MRRRSDKEWYDQLEIAILIRVEDFKIMGYREIEAEHIWSFLVEVIWKDQEDPQLHQRIHD
ILQMKIAELMDFITMGPPDEEMKEDALELLMGEQD
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaagatctgacaaagagtggtacgaccagttagaaatagcaattttaattaga
gtagaagattttaaaattatggggtaccgtgaaatcgaagcggaacatatttggtctttt
ttagtggaagttatttggaaagatcaagaagatccgcagttgcatcaacgcattcacgac
attttgcaaatgaaaatagcagaactaatggactttattacgatgggtccgccagatgag
gaaatgaaggaagatgctttagaacttctgatgggagagcaagactag

DBGET integrated database retrieval system