KEGG   Listeria weihenstephanensis: UE46_14960Help
Entry
UE46_14960        CDS       T05637                                 

Definition
(GenBank) ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UE46_14960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lwi02000]
    UE46_14960
Transporters [BR:lwi02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    UE46_14960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 Zeta_toxin AAA_29 RsgA_GTPase SMC_N AAA_25 AAA_24 FtsK_SpoIIIE DUF87 AAA_16 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AQY52193
UniProt: A0A1S7FXN6
LinkDB All DBs
Position
complement(3125404..3127143)
Genome map
AA seq 579 aa AA seqDB search
MIKSSWIGPYIKQNRMLFLWVILLGLLTVFSTGALMFTSGYLISTAATIPETILLIYVPI
VGVRAFGIMRAVSRYVERLASHSLVLRILAKMRVRLYRIIEPQALLMRSRYRTGDILGLL
SDDIEHLQNYYLTTLLPNIVAMVLYGGIVISLGVFSIPFAILFFAYIALLVLVMPWVSLL
YARGKNAYMKQERNKLYQKFTDAVFGISDWMFSGREKSFIADYEADEKLMLAAETKQARF
ATLRDFIGQLIIGVMVLSMVYWTNEQVVDGVFEPTFIAAFVLAILALSESFIPVSNAVSD
GSLYKDSIARLEEIEDAELLTWEEEGALEKVAIDTQNVTLRTEKLTFGYTDVKPVLRDLD
FELKQGEKIAILGRSGTGKSTFLKLVQGALAPTSGSVTLNGDDVAKLRPQIADMISMLNQ
KAHLFNTTVLNNIRMGNQDATDEEVAEVAKQVKLHDFIMSMPDGYHTQMTEMGARFSGGE
RQRIALARILLQDTPIVVLDEPTVGLDPITEKELLGTIFETLQGKSLVWVTHHLVGVEKM
DRVLFLENGEIIMEGTHQELLHQEERYRHLYELDRPIKL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagtagctggattgggccgtatatcaaacaaaatcggatgcttttcctctgg
gttattttgctcgggttgttgacggtattttcaacgggagcgttaatgtttacatcggga
tatttgatctcgacagcggcaacgattccggagacaattttacttatttatgtgccgatc
gttggtgtgcgggcattcggaatcatgcgtgcggtatcgcgttacgtcgaacgtctggcg
agtcattcgctcgttttgcggattttggcgaaaatgcgtgtgcgtttgtaccgtattatt
gaaccgcaagctttgttgatgcgttcgcgttaccggacgggggatattttggggcttctt
tcggatgatatcgagcatttgcaaaattactatttgacgacgctacttccgaacattgtg
gcaatggttttatatggtgggattgtgatttcacttggcgtcttttcgattccgtttgcg
attctatttttcgcttatatcgcgctgctcgttcttgtgatgccttgggtgtcgctactt
tatgcgcgtggaaaaaatgcgtacatgaagcaggaacggaataagttgtatcaaaaattc
accgatgctgtgtttggtatcagtgactggatgttcagtggtcgtgaaaaaagctttatc
gcggattatgaggcggatgagaaattgatgctggcggctgaaacgaaacaggcgcgtttt
gcgacattgcgcgactttattgggcaactgatcatcggagttatggtgctgtcgatggtg
tattggacaaacgagcaagtcgtggatggcgtttttgaaccgacgtttatcgcggcgttt
gtgttagcgattttagctttatcggagagctttattccggtgagtaatgcggtcagtgat
ggctcgctttacaaggattcgattgcgcgtttggaagagattgaggacgcggaacttctg
acttgggaagaggaaggcgcgcttgaaaaagtggcgatcgatacgcaaaatgtaacttta
cgtacggaaaaactgacttttggttacacagatgtgaaacctgttttgcgagatttggat
tttgagttgaagcaaggcgagaaaatcgcaattttaggccgaagtggtactgggaaatcg
acatttttgaaattagtgcaaggggctttggcgccaacatcaggctcggttacgttaaac
ggggacgatgtggcgaaacttcgaccgcaaatcgcggacatgatttcgatgctgaatcag
aaggcacatttgtttaatacgacggttttgaacaatattcgaatgggaaatcaggatgca
acggatgaagaagtcgcagaggtcgcgaaacaagtgaagttgcacgactttattatgagc
atgccggatggatatcatacgcagatgacggagatgggcgcgcgcttttctggtggtgaa
cgtcaacggattgcactagctcggattttgttacaagatacgccgattgtagtgctagat
gagccaactgtgggacttgatccgattactgagaaggaactactgggaactatttttgag
acgctgcaagggaagtcgctcgtttgggtgacgcatcatcttgttggtgtggagaaaatg
gatcgggtattattcttagagaacggggaaatcatcatggagggaacacatcaggaattg
ttgcatcaggaagaacgttatcgtcacttgtatgagttggatcgtccaattaagctgtga

DBGET integrated database retrieval system