KEGG   Listeria weihenstephanensis: UE46_15690Help
Entry
UE46_15690        CDS       T05637                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lwi  Listeria weihenstephanensis
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UE46_15690
Enzymes [BR:lwi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UE46_15690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 HI0933_like GIDA FAD_oxidored DAO FAD_binding_3 Thi4 NAD_binding_7 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AQY52312
UniProt: A0A1S7FY31
LinkDB All DBs
Position
3297763..3299292
Genome map
AA seq 509 aa AA seqDB search
MALDKEIKDQLAGYLDLLEQNIVLKVSVATDENSQKLLEFVTEIADMSPKIRLERGSLPR
TPSFSVEREDTDFGIVFAGIPLGHEFTSLILALLQVSGRPPKISDEVAAQIKKINAPHHF
ESYVSLTCHNCPDIVQALNIMSVLNPNISHTMIEGSMFKEEVEAKNIMAVPTIFENGSLF
GSGRMTIEQILTNIIGEADASEFEDKEPFDVLVIGGGPAGASAAIYAARKGIRTGIVADT
FGGQVLETLSIENVIGTKYTEGPKLIAQIEEHVNEYGVDVMKQVRAKSIQKNENVEVTLE
NGAILTTKTAIISTGARWRNVGVPGEQEFKNKGVAYCPHCDGPLFEGKNVAVVGGGNSGI
EAAIDLAGTVKHVTVLEFMPELKADEVLQKRLYSLPNVTVLKNVQTKEITGQDKVDGITY
VNRETSEEVHVDVEGVFILIGLAPNTEWLGDDIERNKMGEIITNKHGETSVPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYMIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcattagataaagaaatcaaagaccaactcgcgggctatctggatttactggaacaa
aatattgttttaaaagtaagcgtcgcaacagatgaaaactcgcaaaaattactcgaattc
gtcacagaaatcgcggatatgtctccaaaaatccgtttagaacgcggctcacttccaaga
acaccaagctttagtgtcgaacgtgaagataccgactttggaattgtattcgccgggatt
ccgcttggacatgaatttacttcacttatcttagcattactacaagtaagtggccgtcca
ccgaaaatcagtgatgaagtcgcagcccaaattaaaaaaatcaacgcgccacatcatttt
gaatcttacgtaagtttgacgtgccacaactgccctgatatcgtacaggcgctcaatatc
atgagtgtactgaacccgaatatctcacatacaatgatcgaaggcagcatgtttaaagag
gaagtagaagctaaaaatatcatggctgtaccgactatttttgagaatggctccctattt
gggagtggccgcatgactatcgagcaaatcctcacaaacatcataggcgaagcagatgcc
tctgaatttgaagataaagaaccgttcgacgtcctcgttattggtggcggtccagcaggt
gccagtgccgcgatttatgccgcgcgtaaagggattcgaactggaatcgtagccgataca
ttcggtggtcaagttttagaaacgttaagcatcgagaacgtgatcggcacaaaatataca
gaaggtccaaaactgattgcgcagattgaagaacacgtgaacgaatacggcgttgatgtg
atgaaacaagtacgcgccaaaagcattcagaagaatgaaaacgtggaagtaacgctcgaa
aatggcgctattttaacgactaaaacagcaattatctcgactggtgcaagatggcgtaac
gttggcgttcctggtgaacaggagttcaaaaataaaggcgttgcatattgtccacattgt
gatggtccactttttgaagggaagaatgtcgctgttgtcggcggtggaaactctggcatt
gaggcggcgatcgatctcgctggtaccgtgaagcatgtcactgtactcgaatttatgccg
gaattaaaagccgacgaagttttgcagaaacgtctttattccttaccaaatgtcactgtt
ttgaaaaacgtacaaacgaaggaaattacaggacaggataaagtcgatggcatcacatat
gtgaaccgcgaaacaagcgaagaagtccatgtggatgtagagggagtcttcatcttgatt
ggcctcgcgccgaacacggaatggcttggagacgatatcgagcgtaataaaatgggcgag
attataacgaacaaacacggcgagacaagcgttcccggtgtattcgcagctggggattgc
acagacagcgcctataaacaaatcattatttcgatgggctctggcgctaccgcagcactc
ggcgcatttgattacatgattcgtaactag

DBGET integrated database retrieval system