KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx04510Help
Entry
Lxx04510          CDS       T00190                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00020  Citrate cycle (TCA cycle)
lxx00190  Oxidative phosphorylation
lxx00650  Butanoate metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01200  Carbon metabolism
Module
lxx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lxx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lxx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lxx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lxx04510 (sdhB)
   00650 Butanoate metabolism
    Lxx04510 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lxx04510 (sdhB)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Lxx04510 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Lxx04510 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4 Fer4_4 Fer4_6 Fer4_16 Fer4_18 Fer4_2 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AAT88442
UniProt: Q6AGQ3
LinkDB All DBs
Position
complement(450475..451236)
Genome map
AA seq 253 aa AA seqDB search
MSTAVLETPPAPEAPIPSFTVTLIIRRFDPEKDTEPRWQDFDVELYPTDRILDALHKIKW
EQDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDLDISKPIYVEAIKGLPLEKDLI
VDMEPFFASYREVQPFLIANSTPPEDKERIQSVADRARFDDTTKCILCAACTSSCPVFWT
DGQYFGPAAIVNAHRFIFDSRDDNAQVRLDILNDKEGVWRCRTTFNCTDACPRGIQVTQA
IAEVKQAVMRGKP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgccgtactggagactcccccggctcccgaagcccccatcccgtcgttcacc
gtcacactgatcatccgccgcttcgacccggagaaggacaccgagccgcgctggcaggac
ttcgacgtcgagctgtacccgaccgaccgcatcctggacgcgctgcacaagatcaagtgg
gagcaggacggctcgctcaccttccgccgctcctgcgcccacggcatctgcggctccgac
gcgatgcggatcaacggccgcaaccgcctggcctgcaagacgctgatcaaagacctggac
atctccaagccgatctacgtcgaggcgatcaagggcctgccgctggaaaaggatctcatc
gtcgacatggagccgttcttcgccagctaccgcgaggttcagcccttcctcatcgccaac
agcacgccgccggaggacaaggagcgcatccagtccgtcgccgaccgcgctcgcttcgac
gacacgaccaagtgcatcctgtgcgccgcgtgtacctcgtcctgcccggtcttctggacc
gacggccagtacttcggcccggctgcgatcgtgaacgcccaccgcttcatcttcgactcc
cgcgacgacaacgcgcaggtgcgcctcgacatcctgaacgacaaggagggcgtctggcgc
tgccgcacaaccttcaactgcaccgacgcctgcccccgcggcatccaggtcacccaggcc
atcgccgaggtcaagcaggccgtcatgcgcgggaagccgtag

DBGET integrated database retrieval system