KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx04520Help
Entry
Lxx04520          CDS       T00190                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00020  Citrate cycle (TCA cycle)
lxx00190  Oxidative phosphorylation
lxx00650  Butanoate metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01200  Carbon metabolism
Module
lxx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lxx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lxx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lxx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lxx04520 (sdhA)
   00650 Butanoate metabolism
    Lxx04520 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lxx04520 (sdhA)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Lxx04520 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Lxx04520 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO HI0933_like PSK_trans_fac
Motif
Other DBs
NCBI-ProteinID: AAT88443
UniProt: Q6AGQ2
LinkDB All DBs
Position
complement(451236..453038)
Genome map
AA seq 600 aa AA seqDB search
MTTDTTESTVIDGVHYHEFDIVIVGAGGAGMRAAIEAGPHAKVAVISKLYPTRSHTGAAQ
GGMAAALANVEEDSWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVIDLENMGLPFNRTP
EGKIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLFQNCVKLGINFFNEFYVLDVI
MNEVDGVDQPAGVVAYELATGELHVFHSKAIIFATGGFGKIFKTTSNAHTLTGDGVGIIW
RKKLPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRNASGERFMERYAPTIKDLAPRD
IVARCMVQEVAEGRGAGPHKDYVLLDCTHLCAEVLETKLPDITEFARTYLGVDPVVEPVP
VMPTAHYAMGGIPTNVSAEVLRDNTTVVPGLYAAGECACVSVHGSNRLGTNSLLDINVFG
KRAGTNAVEYAKTATAVPLPEDPAKNVRELIEGLRTSTGTERIAAIRKELQDEMDRNAQV
FRTDESLEKVTGTIHTLRERYKNVVVQDKGKRYNTNLLEAVELGFLLDLAEVVVYSARNR
KESRGGHMRDDFPKRDDENYMKHTMAYLTGDPHSADAADHITLDWKPVVVTRYQPMERKY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgacaactgacacgaccgaatccaccgtcatcgacggtgtccactaccacgagttcgac
atcgtcatcgtcggcgccggtggcgccgggatgcgcgcggccatcgaggccggacctcac
gcgaaggtcgcggtcatctcgaagctctaccccacccgctcccacaccggcgcggcgcag
ggcggcatggccgcagcgctcgccaacgtggaggaggacagctgggagtggcacaccttc
gacacggtcaagggcggcgactatctggtcgaccaggacgcggcggagatcctcgccaag
gaggccatcgacgcggtcatcgacctggagaacatgggcttgccgttcaaccgcacgccc
gagggcaagatcgaccagcgccgcttcggcggtcacacccgcgaccacggcaaggccccg
gtccgccgcgcctgctacgcggccgaccgcaccggccacatgatcctgcagaccctgttc
cagaactgcgtcaagctcggcatcaacttcttcaacgagttctacgtgctcgatgtgatc
atgaacgaggtcgacggcgtcgaccagcccgcgggcgtcgtcgcctacgagctggcgacc
ggcgagctgcacgtcttccactcgaaggcgatcatcttcgccaccggcggcttcggcaag
atcttcaagacgacctccaacgcgcacaccctcacgggcgacggcgtcggcatcatctgg
cgcaagaagctcccgctggaggacatggagttcttccagttccacccgaccggtctggcc
ggcctcggcatcctcctcaccgagggtgcgcgcggcgagggcgccatcctccgcaacgcg
agcggcgagcgcttcatggagcggtacgcgccgaccatcaaggacctcgccccgcgcgac
atcgtcgcccgctgcatggtccaggaggtcgcggagggccgcggcgccgggccgcacaag
gactacgtgctgctcgactgcacccacctgtgcgcggaggtgctggagacgaagctcccg
gacatcaccgagttcgcccgcacctacctgggcgtggacccggtggtcgagccggttccg
gtcatgccgaccgcgcactacgcgatgggcggcatcccgaccaatgtcagcgccgaggtg
ctgcgcgacaacacgaccgtcgtgccgggcctctacgccgccggcgagtgcgcgtgcgtc
tcggtacacggctcgaaccgtctgggcaccaactccctgctcgacatcaacgtgttcggc
aagcgcgccggcaccaacgcggtcgagtacgcgaagaccgcgacggccgtgccgctgccg
gaggacccggccaagaacgtccgcgagctgatcgagggcctccgcacctccaccggcacc
gagcgcatcgccgccatccgcaaagagctgcaggacgagatggaccggaacgcccaggtg
ttccgcaccgacgaatcgctggagaaggtcaccggcaccatccacacgctccgcgagcgc
tacaagaacgtggtcgtgcaggacaagggcaagcgctacaacaccaacctgctggaggcc
gtcgagctcggcttcctgctcgacctcgccgaggtggtcgtctactccgcccgcaaccgc
aaggaatcccgcggcgggcacatgcgcgacgacttccctaagcgcgacgacgagaactac
atgaagcacacgatggcctacctcaccggcgacccgcactcggccgatgcggcggaccac
atcacgctcgattggaagccggtcgtcgtgacccgctaccagccgatggagaggaagtac
tga

DBGET integrated database retrieval system