KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx19490Help
Entry
Lxx19490          CDS       T00190                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00020  Citrate cycle (TCA cycle)
lxx00480  Glutathione metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01200  Carbon metabolism
lxx01210  2-Oxocarboxylic acid metabolism
lxx01230  Biosynthesis of amino acids
Module
lxx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lxx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lxx19490 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lxx19490 (icd)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Lxx19490 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AAT89669
UniProt: Q6AD75
LinkDB All DBs
Position
complement(2008100..2009314)
Genome map
AA seq 404 aa AA seqDB search
MDKIKVEGTVVELDGDEMTRIIWKAIKDSLIHPYLDIDLEYYDLGIQKRDETDDQITIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAFGDQYRATDFTFDGPGTLTLSFQPSDGGEAKSVEVYQAPGAGVALA
MYNQDESIRDFARASFTYGLDRQYPVYLSTKNTILKAYDGRFKDLFQEVFDTEYKEKFDA
AGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLAHRGKLDGNQQLIDFTHTLED
VVVKTVEQGKMTKDLALLVGPEQAFLTTEEFLEAISANLKALLG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggacaagatcaaggttgaaggaacggtcgtcgagctcgatggcgacgagatgacccgc
atcatctggaaggcgatcaaggactcgctcatccacccgtacctcgacatcgacctcgag
tactacgacctcggcatccagaagcgcgacgagaccgacgaccagatcacgatcgacgcc
gcacacgccatccagaagcacggcgtcggcgtcaaatgcgccacgatcaccccggacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggaagagcccgaacggcaccatccgc
aacatcctcggcggcgtggtgttccgcgagccgatcatcatctccaacatcccgcggctc
gtccccggctggaacaagccgatcatcatcggccgccacgccttcggcgaccagtaccgc
gccaccgattttaccttcgacggcccgggcaccctcaccctcagcttccagccgagcgac
ggcggagaggccaagagcgtcgaggtgtaccaggcgccgggcgccggtgtcgcactggcc
atgtacaaccaggacgaatccatccgcgacttcgcccgggcctctttcacctacgggctg
gaccggcagtatccggtgtacctctcgaccaagaacaccatcctgaaggcctacgatggc
cggttcaaagacctgttccaggaggtcttcgacactgagtacaaggagaagttcgacgcg
gccgggctcacctatgagcaccgtctcatcgacgacatggtggcctccagcctcaaatgg
gagggcggctacgtctgggcgtgcaagaactacgacggcgatgtccagtccgacacggtg
gcccaggggttcggctcgctcggtctgatgacctcggtcctgaccacgccggacggcaag
gtcgtcgaggcggaggccgcgcacggaacggtgacccgccactaccgccagcaccagcag
ggcaagccgacctccaccaacccgatcgcctcgatcttcgcctggacgcgcgggctcgcg
caccggggcaaactcgacggcaaccagcagctcatcgacttcacccacactctcgaagat
gtcgtggtgaagacggtcgagcagggcaagatgaccaaggatctcgccctcctggtcggc
ccggagcaggcgttcctgacgacggaggagttcctcgaggcgatcagtgcgaacctcaag
gcgctcctgggctga

DBGET integrated database retrieval system