KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_05460Help
Entry
O159_05460        CDS       T02852                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
lxy00564  Glycerophospholipid metabolism
lxy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lxy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    O159_05460
Enzymes [BR:lxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     O159_05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GMC_oxred_N NAD_binding_8 HTH_28
Motif
Other DBs
NCBI-GeneID: 17047646
NCBI-ProteinID: AGW40741
UniProt: U3P4N8
LinkDB All DBs
Position
511804..513612
Genome map
AA seq 602 aa AA seqDB search
MSAPSRLGPAERAAAIAALKDTELDILVVGGGIVGTGSAVDAVTRGLSVGLVEARDFASG
TSSRSSKLVHGGIRYLEQLDFGLVREALIERGLLLQRIAPHLVKPVRFLYPLHKRVWERF
YIGAGMMLYDIFSYTGLRPPGVPHHRHLSRRQVLRAIPSLTPNALVGGITYYDAQVDDAR
YVATLARTAAHYGARVAARVRVEGFVKVGERVVGVRARDLETDERFEIRAKQVVNATGVW
TDDTQAMVGERGQFKVRASKGIHLVVPRDRFQSKMGLLLRTEKSVLFVIPWGRHWLIGTT
DTDWNLDKAHPAATAADIDYLLAHVNEVLNVPLTREDVEGVYAGLRPLLAGESEETSKLS
REHLVAHSVPGLVVIAGGKWTTYRVMAKDAIDAAVDALDGKIPASATMEIALVGAEGYQA
AWNSRGRIARESGLHPARIERFLNRYGTMTGDILALIREDPALAEPLPGADDYVAAEVVY
AASHEGALHLEDVLARRTRISIEAWDRGASAAPVAASLMARVLGWDRAREEREVQTYLLR
VAAERESQLQPDDESADRVRLEAPDIVAVDAAAETGSAAKAPRTAAASRTAAAPRTPKEP
KG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgctccatcgcgactcggccccgccgaacgggccgccgcgatcgcggcgctgaag
gacaccgaactcgacatcctggtcgtgggcggcggcatcgtcggcaccggcagcgcggtg
gacgccgtcacccgcggtctgagcgtggggctggtggaggcgcgcgacttcgcttcgggc
acctccagccggtcgtccaagctcgtccacggcggcatccggtacctggagcagctggac
ttcggcctcgtgcgcgaggcgctcatcgagcgcggtctgctgctccagcggatcgcgccc
cacctcgtgaagccggtgcggttcctgtacccgctgcacaagcgagtgtgggagcgcttc
tacatcggcgccgggatgatgctgtacgacatcttctcctacaccggtctgcgcccgccg
ggagtcccgcaccaccgccacctcagccgacgccaggtgctcagagccatcccgagcctg
acgccgaacgccctggtgggcggcatcacctattacgacgcgcaggtcgacgacgcccgc
tacgtggccaccctcgcccgcaccgcggcgcactacggcgcccgggtcgccgcccgcgtc
cgggtcgagggcttcgtcaaggtcggcgagcgcgtcgtcggcgtgcgggcgcgcgatctg
gagacggacgaacggttcgagatccgcgccaagcaggtcgtgaacgcgaccggcgtctgg
acggacgacacccaggcgatggtgggggagcgcggtcagttcaaggtgcgcgcctcgaag
ggcatccacctcgtcgttccgcgcgaccgcttccagtcgaagatgggtctgctgctgcgc
accgagaagagcgtgctgttcgtgatcccgtggggccggcactggctcatcggcacgacc
gacaccgactggaacctcgacaaggcccacccggcggcgaccgcggccgacatcgactac
ttgctggcccacgtcaacgaagtgctcaacgtccccctcacccgcgaggacgtggagggt
gtctacgccggcctccgcccgcttctggcgggagagtcggaggagacctcgaaactctcc
cgcgagcacctcgtggcgcattccgtgcccgggctcgtcgtgatcgcgggcggcaagtgg
acgacctaccgtgtgatggcgaaggacgcgatcgacgccgccgtggacgcgctcgacggc
aagatcccggccagcgccacaatggagatcgcgctcgtcggagccgaaggctaccaggcc
gcctggaacagccgcggccgcatcgcgcgggagagcggcctccatcccgcccgcatcgag
cgcttcctcaaccgctatgggacgatgaccggcgacatcctggcgctcatccgcgaagac
ccggcgctcgccgaaccgctcccgggcgccgacgactacgtggccgccgaggtcgtctac
gccgcctcccacgagggcgccctgcacctcgaagacgtcctcgcccgccgcacccgtatc
tccatcgaagcctgggaccgcggcgcctcggcggcgcccgtcgccgcatccctgatggcc
agggtgctcggctgggacagggcccgcgaagaacgcgaggtgcagacctacctgctgcgc
gtcgccgccgaacgcgagagccagcttcagcccgatgacgaatccgccgaccgcgtgcgg
ctcgaagcgccggacatcgtggcggtggacgccgcggccgagaccgggtccgcggcgaaa
gcgccgcggacggcagcagcgtcccggacggcagcagcgccgcggacgcccaaggagcct
aaggggtag

DBGET integrated database retrieval system