KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_16430Help
Entry
O159_16430        CDS       T02852                                 

Definition
(GenBank) serine/threonine kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Brite
KEGG Orthology (KO) [BR:lxy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lxy01001]
    O159_16430
Enzymes [BR:lxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     O159_16430
Protein kinases [BR:lxy01001]
 Serine/threonine kinases: Other
  Bacterial family
   O159_16430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal Haspin_kinase RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 17048597
NCBI-ProteinID: AGW41692
UniProt: U3PA12
LinkDB All DBs
Position
1574358..1576259
Genome map
AA seq 633 aa AA seqDB search
MTTSQTDPLIGRLIDGRYQVRSRIARGGMATVYLATDLRLERRVAIKVMHGHLADDTTFK
NRFVQEARSAARLAHPNVVNVFDQGQDSDMAYLVMEYLPGITLRDLLKDYGKLTPEQTID
IMEAVLSGLAAAHKAGIVHRDLKPENVLLADDGRIKIGDFGLARAASANTATGQALLGTI
AYLSPELVTRGVADARSDIYALGIMMYEMLTGEQPFQGEQPMQIAYQHANDAVPTPSGKN
TAVPAELDDLVQWATEKDPDRRPKDARELFDRLVEAEKSLRGEAGLQPTMVLPPAFEAAE
GNTQIINPAIRQQVAANTPSATERLSAASARRRAKGWWLFAFVILLAGLAGGTGWYFGAG
PGSLVSVPNVVSKTPAAAAAQLTELGFRTRQTQEYSVTVPAGQVSSTVPVAETSAGRGST
VTLRVSQGPKPVTIPPLAGHPLDTAKAAIAGVGAKVGAVAEQFDGKVHSGTVISATKTSD
GGDISGGGPYFEAASVDLVVSVGPVPDVAGKSVESATALLRKAGLVVTAGPESYSETIAK
GDVISAQPQSAVVRPGDTVALTTSKGPEPVPVPDVVGQTWDKAKKTLTEAGFALKYSSAA
DLLPAAFVVSKISPGAGTQADKGSTVTVNFAGF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgagccagaccgatcccctgatcggccgtctgatcgacggccgctatcaggtg
cgctcgcggatcgcgcgcggcgggatggccacggtctacctcgccacagatctgcgcctc
gagcgccgcgtggcgatcaaggtgatgcacggccacctcgccgacgacaccaccttcaag
aaccgcttcgttcaggaagcccgctcggccgcgcgcctcgcgcacccgaacgtggtcaat
gtcttcgaccagggccaggactccgacatggcgtatctggtcatggagtacctgcccggg
atcacgctccgcgatctgctcaaggactacggcaaactcacgcccgagcagaccatcgac
atcatggaggcggtgctgagcgggctcgccgccgcccacaaggcgggcatcgttcaccgc
gacctgaaacccgagaacgtgctgctcgccgacgacggacgcatcaagatcggcgacttc
ggcctcgcccgcgccgcgagcgcgaacaccgccaccggccaggcgctcctcggcacgatc
gcctacctctcgcccgaactcgtcacccgcggcgtcgcggacgcccgcagcgacatctac
gcgctcggcatcatgatgtacgagatgctgaccggcgagcagcccttccagggcgaacag
ccgatgcagatcgcctaccagcacgccaacgacgcggtcccgacgccgagcggcaagaac
acggccgtgcccgccgagctcgacgatctcgtgcagtgggcgaccgagaaggacccggac
cgccgccccaaggacgctcgcgagctgttcgaccggctcgtcgaggccgagaagtccctt
cgcggcgaagccggcctccagccgactatggtgctgccgccggcgttcgaggcggcggag
ggcaacacccagatcatcaacccggccatccgccagcaggtcgccgccaacacgcccagc
gccaccgaacggctgagcgccgcctccgcgcgccgccgagcgaagggctggtggctgttc
gcgttcgtcatcctgctcgcgggactggccggcggcaccggatggtacttcggcgccggt
cccggctcgctcgtcagcgtcccgaacgtggtcagcaagacacccgccgccgccgccgcg
cagctcacggagctcggattccggacccgacagacgcaggagtacagcgtgaccgtgccc
gccgggcaggtctcgagcaccgttccggtggccgagacatcggccgggcgtggctcgacc
gtgacgctgcgcgtctcccagggcccgaagccggtcaccatcccgccgctcgccggacac
cccctcgacacagcgaaggccgcgatcgccggcgtcggggcgaaggtgggggccgtcgcc
gagcagttcgacggcaaggtacactccggaaccgtcatctccgcgacgaagacctccgac
gggggcgacatctccggcggcggaccgtatttcgaggcggcctccgtcgatctcgtggtg
tcggtcggtcccgttccggatgttgcggggaagtctgtggagagcgccaccgcgctcctg
cgcaaggcgggcctcgtagtcaccgccgggccggaaagctacagcgagaccatcgccaag
ggcgacgtgatctccgcacaaccgcagtccgcggtggtccgtccgggcgacaccgtcgcc
ctgacgacatcgaaaggccccgagccggtccctgttccggacgtggtcggccaaacctgg
gacaaggccaagaagaccctcaccgaggcgggcttcgctctcaagtactcctctgccgcc
gatctcctcccggccgcgttcgtcgtctccaagatcagccccggagccggaacccaggcc
gataagggctccaccgtcaccgtcaacttcgccggcttctaa

DBGET integrated database retrieval system