KEGG   Lysinibacillus sp. B2A1: C3943_10660Help
Entry
C3943_10660       CDS       T05347                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
lyb  Lysinibacillus sp. B2A1
Pathway
lyb00020  Citrate cycle (TCA cycle)
lyb00190  Oxidative phosphorylation
lyb00650  Butanoate metabolism
lyb01100  Metabolic pathways
lyb01110  Biosynthesis of secondary metabolites
lyb01120  Microbial metabolism in diverse environments
lyb01130  Biosynthesis of antibiotics
lyb01200  Carbon metabolism
Module
lyb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lyb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3943_10660
   00650 Butanoate metabolism
    C3943_10660
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C3943_10660
Enzymes [BR:lyb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C3943_10660
    1.3.5.4  fumarate reductase (quinol)
     C3943_10660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like Pyr_redox_2 GIDA AlaDh_PNT_C FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AVK84002
UniProt: A0A2S0JKT2
LinkDB All DBs
Position
2295993..2297747
Genome map
AA seq 584 aa AA seqDB search
MAKSKIIVVGGGLAGLMATIKAAEVGTEVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKGMCDAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTL
MHRTAFSGATTGQQLLYALDEQVRSHEVAGLVNKYEHWEFLGVIIDEDGVCRGIVAQDMR
TEEIKSFRADAVIMATGGPGIIFGKTTNSVINTGSAASIVYQQGASYANGEFIQIHPTAI
PGDDKNRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFVGDDPRKLPMKIFPAVHYSMGGLWV
DYNQMTEIPGLFAAGECDYSQHGANRLGANSLLSAIYGGMVAGPNAVDYVKHLKKHAEDL
PQQIYDARVKEEQDKWDAIMKLDGTENAYLLHKELGEMMTATMTVVRYNDQLEDTLKKLD
ELTERWNNININDTQKWSNQGAHFTRQLKNMLILAKVMTQGALLRNESRGAHYKPDFPNR
DDENFLKTTIAKFDPTTGNPIITYQEVDVSLIPPRKRDYSAKGD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaagcaaaataattgttgtcggcggcggtcttgctggtctgatggcaacgatt
aaagcagctgaagttggtactgaagttgatttattctcattagttcctgtaaaacgctca
cactctgtatgtgcgcaaggcggaattaatggtgcggtaaatacaaaaggtgaaggggat
tctccttggattcactttgatgatacagtgtatggtggggacttcttagctaaccaacca
ccagttaagggtatgtgtgatgcggctcctggtattattcacttaatggaccgtatgggt
gttatgttcaaccgtacacctgaaggacttcttgatttccgtcgttttggcggtacttta
atgcaccgtactgcattctcaggtgcaacaactggtcaacaattactatatgcactagat
gagcaagttcgttctcacgaagtggctggtttagttaataaatatgagcactgggaattc
cttggtgtaattattgacgaagatggcgtttgccgtggtatcgttgcgcaagatatgcgt
acagaagaaattaaatcattccgtgcagacgctgttattatggcgactggaggtcctggt
attatcttcggtaaaacaacaaactctgtcattaacacaggttctgctgcttctatcgtt
taccaacaaggtgcttcttatgcgaatggtgaattcatccaaattcaccctacagcgatt
cctggagatgacaaaaaccgtttaatgtcagaatcggctcgtggtgaaggtggacgtatt
tggacttataaagacggtaagccttggtacttcttagaagagaaatacccagcttatggt
aacttagtaccacgtgatattgcaacacgtgaaattttcgacgtttgtgtaaaccaaaaa
cttggtatcaatggcgaaaacatggtatacctagatctttctcataaagatccacatgaa
ttagacgttaaacttggtggtatcatcgagatttacgaaaaattcgtaggggatgaccca
cgtaaattacctatgaaaattttcccagcagttcactattcaatgggtggattatgggtt
gactacaaccaaatgactgaaatacctggtctatttgcagcaggtgaatgtgattattct
caacatggtgcaaaccgtcttggtgcgaactcattattatctgctatttatggcggtatg
gttgctggtcctaacgcagtagactacgtaaaacatcttaaaaagcatgcagaagactta
ccacaacaaatctacgatgctcgcgttaaagaagaacaagataagtgggatgctatcatg
aaattggacggcacggaaaacgcttacttgcttcataaagagcttggtgagatgatgact
gctacgatgacagtagtacgttataacgaccaacttgaagatacattaaaaaaattagat
gagcttactgagcgttggaataacatcaacatcaatgatacacaaaaatggagcaaccaa
ggtgcacactttacacgtcagcttaaaaacatgttaattctagcgaaagtaatgacacaa
ggtgcattattgcgtaatgaatctcgcggtgctcactataaaccagatttcccgaaccgt
gatgatgaaaacttcttaaaaacaacaattgcgaagtttgatccaactactggtaatcca
atcatcacgtaccaagaagtcgacgtttctttaattccaccacgtaaacgcgactactct
gcgaaaggagactaa

DBGET integrated database retrieval system