KEGG   Lysinibacillus sp. B2A1: C3943_10665Help
Entry
C3943_10665       CDS       T05347                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lyb  Lysinibacillus sp. B2A1
Pathway
lyb00020  Citrate cycle (TCA cycle)
lyb00190  Oxidative phosphorylation
lyb00650  Butanoate metabolism
lyb01100  Metabolic pathways
lyb01110  Biosynthesis of secondary metabolites
lyb01120  Microbial metabolism in diverse environments
lyb01130  Biosynthesis of antibiotics
lyb01200  Carbon metabolism
Module
lyb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lyb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3943_10665
   00650 Butanoate metabolism
    C3943_10665
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C3943_10665
Enzymes [BR:lyb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C3943_10665
    1.3.5.4  fumarate reductase (quinol)
     C3943_10665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4 Fer4_2 Fer4_17 Fer4_18 Fer4_21 Fer4_15 Fer4_4 Fer2_4 Fer4_13 Fer4_3 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AVK84003
UniProt: A0A2S0JKM0
LinkDB All DBs
Position
2297753..2298532
Genome map
AA seq 259 aa AA seqDB search
MQIAANTGRMVKVEILRQDTKGGNSYWQKFQVPYRHGMNVISILMEIQKNPVTENGENTS
PVAWDMNCLEEVCGACSMVINGRPRQSCSTLVDQLTEPIKLEPMKTFPVIRDLQVDRERM
FNALKKVKAWVPIDGTYDLGEGPRMPEGKRQWAYELSKCMTCGVCMEACPNVSEKASFIG
PAPLSQVRLFNTHPTGAMIKDQRLNAIMGDGGLANCGNSQNCVAACPKGIPLTTSIASLN
RATTVQMFRNFFGSDHFVD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgcagcaaatactggaagaatggtcaaagtggaaattttacgtcaagatact
aaaggcggcaatagctactggcaaaaattccaagtaccttaccgtcatggtatgaacgta
atttcaattttaatggaaattcaaaaaaatcctgttactgaaaatggtgaaaatacttca
ccagtagcatgggatatgaactgtttagaagaggtttgtggtgcatgttcaatggttatt
aatggtcgcccacgtcaatcttgttcaacacttgttgaccaattgactgagcctattaaa
ctagagcctatgaaaacattccctgttattcgtgacttacaagttgaccgtgaacgtatg
ttcaacgcactgaaaaaagtgaaagcatgggtgccaatcgatggtacttatgatttaggt
gaaggtccgcgtatgccagaaggtaaacgtcaatgggcttatgaattatctaaatgtatg
acttgtggtgtatgtatggaagcttgtccaaacgtgtctgaaaaagcttcattcatcgga
ccagcaccattatcacaagtacgtttatttaacactcacccaactggtgcgatgattaaa
gaccaacgtttaaacgcaattatgggtgatggaggccttgcaaactgtggtaactctcaa
aactgtgttgctgcttgtccaaaaggtattcctttaacaacatctatcgcatcattaaac
cgtgcaactacagtgcaaatgttccgtaacttcttcggttctgaccacttcgttgactaa

DBGET integrated database retrieval system